SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YMR169C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR169C
Domain Number 1 Region: 12-501
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-157
Family ALDH-like 0.00000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
lipid particle 1.519 5.27
mitochondrial matrix 1.716 4.79

Protein sequence

External link(s) Locus: YMR169C   Protein: S000004779
Sequence length 506
Comment ALD3 SGDID:S000004779, Chr XIII from 600871-599351, reverse complement, Verified ORF, "Cytoplasmic aldehyde dehydrogenase, involved in beta-alanine synthesis; uses NAD+ as the preferred coenzyme; very similar to Ald2p; expression is induced by stress and repressed by glucose"
Sequence
MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDV
DKAVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD
LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ
GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK
ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ
ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY
IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY
DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI
GRESGDTGVDNYLQIKSVHVDLSLDK
Download sequence
Identical sequences P54114
YMR169C YMR169C 4932.YMR169C YMR169C YMR169C YMR169C YMR169C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]