SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR169C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR169C
Domain Number 1 Region: 12-501
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-157
Family ALDH-like 0.00000000185
Further Details:      
 

Protein sequence

External link(s) Locus: YMR169C   Protein: S000004779
Sequence length 506
Comment ALD3 SGDID:S000004779, Chr XIII from 600871-599351, reverse complement, Verified ORF, "Cytoplasmic aldehyde dehydrogenase, involved in beta-alanine synthesis; uses NAD+ as the preferred coenzyme; very similar to Ald2p; expression is induced by stress and repressed by glucose"
Sequence
MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDV
DKAVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQD
LAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQ
GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDK
ISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQ
ICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY
IERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNY
DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEAKVPFGGFKMSGI
GRESGDTGVDNYLQIKSVHVDLSLDK
Download sequence
Identical sequences P54114
YMR169C YMR169C 4932.YMR169C YMR169C YMR169C YMR169C YMR169C

Jump to [ Top of page · Domain architecture · Domain assignment details ]