SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR175W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YMR175W-A   Protein: S000028848
Sequence length 64
Comment YMR175W-A SGDID:S000028848, Chr XIII from 611313-611507, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MNCLCLCSLYSKSISAYFSEFSSTNIYKSYLRLPSVLYYVCMMHTMMPNQLDAVGIQSSE
SLLM
Download sequence
Identical sequences A6ZMN5 C8ZF38 Q3E766
YMR175W-A YMR175W-A 4932.YMR175W-A YMR175W-A YMR175W-A tr|A6ZMN5|A6ZMN5_YEAS7 YMR175W-A YMR175W-A YMR175W-A YMR175W-A YMR175W-A YMR175W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]