SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR175W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR175W-A   Protein: S000028848
Sequence length 64
Comment YMR175W-A SGDID:S000028848, Chr XIII from 611313-611507, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MNCLCLCSLYSKSISAYFSEFSSTNIYKSYLRLPSVLYYVCMMHTMMPNQLDAVGIQSSE
SLLM
Download sequence
Identical sequences A6ZMN5 C8ZF38 N1NXH3 Q3E766 W7PC08
YMR175W-A YMR175W-A 4932.YMR175W-A YMR175W-A YMR175W-A tr|A6ZMN5|A6ZMN5_YEAS7 YMR175W-A YMR175W-A YMR175W-A YMR175W-A YMR175W-A YMR175W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]