SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR186W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR186W
Domain Number 1 Region: 268-523
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.87e-104
Family Hsp90 middle domain 3.21e-10
Further Details:      
 
Domain Number 2 Region: 4-211
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.76e-72
Family Heat shock protein 90, HSP90, N-terminal domain 6.96e-09
Further Details:      
 
Domain Number 3 Region: 545-668
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 2.09e-34
Family HSP90 C-terminal domain 0.0012
Further Details:      
 

Protein sequence

External link(s) Locus: YMR186W   Protein: S000004798
Sequence length 705
Comment HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels than HSP82 and induced 2-3 fold by heat shock"
Sequence
MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEP
DLFIRITPKPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQF
GVGFYSLFLVADRVQVISKNNEDEQYIWESNAGGSFTVTLDEVNERIGRGTVLRLFLKDD
QLEYLEEKRIKEVIKRHSEFVAYPIQLLVTKEVEKEVPIPEEEKKDEEKKDEDDKKPKLE
EVDEEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSDITQEEYNAFYKSISNDWEDPL
YVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSF
VKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFDKFYSAFAKN
IKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEK
SPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEI
KEYEPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMS
SYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLFETALLTSGFSLEEPTSF
ASRINRLISLGLNIDEDEETETAPEASTEAPVEEVPADTEMEEVD
Download sequence
Identical sequences A6ZMP7 B3LM73 E7KSV8 E7QJF5 G2WKP1 P15108
YMR186W YMR186W YMR186W YMR186W YMR186W YMR186W YMR186W 4932.YMR186W YMR186W SCRT_02079 YMR186W tr|A6ZMP7|A6ZMP7_YEAS7 YMR186W YMR186W YMR186W YMR186w___KOG0019

Jump to [ Top of page · Domain architecture · Domain assignment details ]