SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR186W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR186W
Domain Number 1 Region: 268-523
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.87e-104
Family Hsp90 middle domain 3.21e-10
Further Details:      
 
Domain Number 2 Region: 4-211
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.76e-72
Family Heat shock protein 90, HSP90, N-terminal domain 6.96e-09
Further Details:      
 
Domain Number 3 Region: 545-668
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 2.09e-34
Family HSP90 C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 66.81
nuclear chromosome 1.72 22.01
chromosomal part 1.477 22.01
condensed chromosome 2.188 22.01
ribosomal subunit 2.011 10.3
ribonucleoprotein complex 1.418 9.37
small nuclear ribonucleoprotein complex 2.005 6.93
microbody 1.956 6.65
organellar ribosome 2.15 6.46
chromatin 1.902 6.07

Protein sequence

External link(s) Locus: YMR186W   Protein: S000004798
Sequence length 705
Comment HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels than HSP82 and induced 2-3 fold by heat shock"
Sequence
MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPKQLETEP
DLFIRITPKPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQF
GVGFYSLFLVADRVQVISKNNEDEQYIWESNAGGSFTVTLDEVNERIGRGTVLRLFLKDD
QLEYLEEKRIKEVIKRHSEFVAYPIQLLVTKEVEKEVPIPEEEKKDEEKKDEDDKKPKLE
EVDEEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSDITQEEYNAFYKSISNDWEDPL
YVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSF
VKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFDKFYSAFAKN
IKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEK
SPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEI
KEYEPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALRDSSMS
SYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLFETALLTSGFSLEEPTSF
ASRINRLISLGLNIDEDEETETAPEASTEAPVEEVPADTEMEEVD
Download sequence
Identical sequences A6ZMP7 B3LM73 E7KSV8 E7QJF5 G2WKP1 P15108 W7RG66
YMR186W YMR186W YMR186W YMR186W YMR186W YMR186W YMR186W 4932.YMR186W YMR186W SCRT_02079 YMR186W tr|A6ZMP7|A6ZMP7_YEAS7 YMR186W YMR186W YMR186W YMR186w___KOG0019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]