SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR194W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YMR194W   Protein: S000004807
Sequence length 100
Comment RPL36A SGDID:S000004807, Chr XIII from 651144-651159,651623-651909, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Bp and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA"
Sequence
MTVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDL
IRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
Download sequence
Identical sequences P05745
YMR194W 4932.YMR194W YMR194W YMR194W 3izc.k 3izs.k 3u5e.i 3u5i.i 4b6a.i YMR194W YMR194W

Jump to [ Top of page · Domain architecture · Domain assignment details ]