SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR194W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR194W   Protein: S000004807
Sequence length 100
Comment RPL36A SGDID:S000004807, Chr XIII from 651144-651159,651623-651909, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Bp and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA"
Sequence
MTVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDL
IRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
Download sequence
Identical sequences N1P5S3 P05745
4932.YMR194W YMR194W YMR194W 1vw8.j 1vwu.j 1vxv.j 1vxy.j 3izc.k 3izs.k 3j65.g 3u5e.i 3u5i.i 4b6a.i 4cuw.i YMR194W YMR194W YMR194W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]