SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR198W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR198W
Domain Number - Region: 259-363
Classification Level Classification E-value
Superfamily Tropomyosin 0.000549
Family Tropomyosin 0.0062
Further Details:      
 

Protein sequence

External link(s) Locus: YMR198W   Protein: S000004811
Sequence length 594
Comment CIK1 SGDID:S000004811, Chr XIII from 659744-661528, Verified ORF, "Kinesin-associated protein required for both karyogamy and mitotic spindle organization, interacts stably and specifically with Kar3p and may function to target this kinesin to a specific cellular role; has similarity to Vik1p"
Sequence
MNNSKIPKLSFHSDPNNVTRDFPKTKRQKVQKREMDMILTPNNNKLNILHSSGSGIRRCY
TDDTSATYTKKLTFGGDPKIIERVKNNERKVRKDIDSLLNAISEIEKESVRIHARELPAI
TLELDAKVKACRELQNEIDGLSTEMDLKDNQCDLQRKNVELSSKNIVSMHAVKVQEFEND
LEEELSNAKREWTYKLMEVENLKPDERLTDEMRQLKTEFEEVNRKLFILQNENENECKNY
KKELDKKFEIFKKVKNDARIELDGEQERLSKVLKDLQDTHGELKENIKTCRDEFNDFEKR
IGEAEVNFHSMELAVVPLKKKLASTSQALTQVQEEKKQVEGEANNWKKKYVNELEKVQQE
LYTRQNLATSIEEIKGYTRCFAYANERQMPDEFHINYVDRCICENSGEKRVQVFDRVVLE
EIHKDHKRLYNECIPFLEKYISKLINCSIIVVSQQPTAPMKKTLLKQLIEQYGENYKMTL
NILHLDGSIKHSDVGLDNPTEIRDLSQDEECMNILTLDTKLGKDEESHSMNIYIGSMSTV
QLNRELDDAPSVLSHILTKTKQCFVFKINAGENIEKALALAGKLKRTITLPQLD
Download sequence
Identical sequences Q01649
YMR198W 4932.YMR198W YMR198W YMR198W YMR198W

Jump to [ Top of page · Domain architecture · Domain assignment details ]