SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR198W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR198W
Domain Number - Region: 259-363
Classification Level Classification E-value
Superfamily Tropomyosin 0.000549
Family Tropomyosin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR198W   Protein: S000004811
Sequence length 594
Comment CIK1 SGDID:S000004811, Chr XIII from 659744-661528, Verified ORF, "Kinesin-associated protein required for both karyogamy and mitotic spindle organization, interacts stably and specifically with Kar3p and may function to target this kinesin to a specific cellular role; has similarity to Vik1p"
Sequence
MNNSKIPKLSFHSDPNNVTRDFPKTKRQKVQKREMDMILTPNNNKLNILHSSGSGIRRCY
TDDTSATYTKKLTFGGDPKIIERVKNNERKVRKDIDSLLNAISEIEKESVRIHARELPAI
TLELDAKVKACRELQNEIDGLSTEMDLKDNQCDLQRKNVELSSKNIVSMHAVKVQEFEND
LEEELSNAKREWTYKLMEVENLKPDERLTDEMRQLKTEFEEVNRKLFILQNENENECKNY
KKELDKKFEIFKKVKNDARIELDGEQERLSKVLKDLQDTHGELKENIKTCRDEFNDFEKR
IGEAEVNFHSMELAVVPLKKKLASTSQALTQVQEEKKQVEGEANNWKKKYVNELEKVQQE
LYTRQNLATSIEEIKGYTRCFAYANERQMPDEFHINYVDRCICENSGEKRVQVFDRVVLE
EIHKDHKRLYNECIPFLEKYISKLINCSIIVVSQQPTAPMKKTLLKQLIEQYGENYKMTL
NILHLDGSIKHSDVGLDNPTEIRDLSQDEECMNILTLDTKLGKDEESHSMNIYIGSMSTV
QLNRELDDAPSVLSHILTKTKQCFVFKINAGENIEKALALAGKLKRTITLPQLD
Download sequence
Identical sequences N1NXJ4 Q01649
YMR198W 4932.YMR198W YMR198W YMR198W YMR198W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]