SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR213W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR213W
Domain Number 1 Region: 9-92
Classification Level Classification E-value
Superfamily Homeodomain-like 1.03e-17
Family Myb/SANT domain 0.013
Further Details:      
 
Weak hits

Sequence:  YMR213W
Domain Number - Region: 551-586
Classification Level Classification E-value
Superfamily GreA transcript cleavage protein, N-terminal domain 0.0759
Family GreA transcript cleavage protein, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
cell fate specification 2.061 47.42
cell fate commitment 1.398 44.89
diencephalon development 2.152 39.03
neuron fate commitment 2.068 36.33
embryonic skeletal system development 1.617 35.6
spinal cord development 2.207 32.54
RNA biosynthetic process 1.516 29.42
mesoderm development 1.675 25.06
gastrulation 1.442 25.06
mesoderm formation 1.823 25.06
Cellular Component IC (bits) H-Score
transcription factor complex 1.912 44.25
nucleoplasm part 1.496 23.62
SWI/SNF superfamily-type complex 2.178 22.11
chromosomal part 1.477 14.08
transferase complex 1.423 6.99
chromosomal region 1.98 5.91
microtubule cytoskeleton 1.341 5.77
centrosome 1.793 5.77
chromatin 1.822 5.56
nuclear chromosome 1.73 4.32

Protein sequence

External link(s) Locus: YMR213W   Protein: S000004826
Sequence length 590
Comment CEF1 SGDID:S000004826, Chr XIII from 693380-695152, Verified ORF, "Essential splicing factor; associated with Prp19p and the spliceosome, contains an N-terminal c-Myb DNA binding motif necessary for cell viability but not for Prp19p association, evolutionarily conserved and homologous to S. pombe Cdc5p"
Sequence
MPPVPIYVKGGVWTNVEDQILKAAVQKYGTHQWSKVASLLQKKTARQSELRWNEYLNPKL
NFTEFSKEEDAQLLDLARELPNQWRTIADMMARPAQVCVERYNRLLESEDSGGAALSTGV
TDLKAGDINPNAETQMARPDNGDLEDEEKEMLAEARARLLNTQGKKATRKIRERMLEESK
RIAELQKRRELKQAGINVAIKKPKKKYGTDIDYNEDIVYEQAPMPGIYDTSTEDRQIKKK
FEQFERKVNRKGLDGNKDKPSKKNKDKKRKHDENEHVEKAALGESTTLTDEYKKPKLILS
APGTKQGKVTYKKKLESKRQKLIEAQATGTVLTPKELLPHDSGQEDNERSNIKSGKQLKS
RIRKFLVQMFASLPSPKNDFEIVLSEDEKEEDAEIAEYEKEFENERAMNEEDNFIEPPSQ
NDAPRVSLVAVPLAYSTLPIPEFKNNPQSAIDNKYNLLVANAINKEPHMVPEDTVDFLKE
VESRMQHITQGRTSMKIQFKTAMPPTEVLLESIQSKVESIEQLQRKLQHVQPLEQQNNEM
CSTLCHHSLPALIEGQRKYYADYYAYRQEIRSLEGRRKRLQAMLNSSSSI
Download sequence
Identical sequences E7KSY0 Q03654 W7QUQ1
YMR213W YMR213W YMR213W 4932.YMR213W YMR213W YMR213W YMR213W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]