SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR213W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR213W
Domain Number 1 Region: 9-92
Classification Level Classification E-value
Superfamily Homeodomain-like 1.03e-17
Family Myb/SANT domain 0.013
Further Details:      
 
Weak hits

Sequence:  YMR213W
Domain Number - Region: 551-586
Classification Level Classification E-value
Superfamily GreA transcript cleavage protein, N-terminal domain 0.0759
Family GreA transcript cleavage protein, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
endocrine system development 1.681 40.61
cell fate specification 1.993 36.66
cell fate commitment 1.4 33.46
diencephalon development 2.237 30.86
forebrain development 1.469 29.05
endocrine pancreas development 1.998 28.42
pancreas development 1.741 26.94
regulation of cell fate commitment 2.15 24.05
gastrulation 1.536 23.99
regulation of apoptotic process 1.258 22.83
Cellular Component IC (bits) H-Score
protein-DNA complex 1.923 18.12
chromosomal part 1.512 12.74
nucleoplasm part 1.369 11.17
ATPase complex 2.002 11.05
nuclear transcription factor complex 2.016 8.32
chromosomal region 1.996 7.51
transferase complex 1.369 7.08
microtubule cytoskeleton 1.44 5.46
centrosome 2.023 5.46
nuclear chromosome part 1.842 4.92

Protein sequence

External link(s) Locus: YMR213W   Protein: S000004826
Sequence length 590
Comment CEF1 SGDID:S000004826, Chr XIII from 693380-695152, Verified ORF, "Essential splicing factor; associated with Prp19p and the spliceosome, contains an N-terminal c-Myb DNA binding motif necessary for cell viability but not for Prp19p association, evolutionarily conserved and homologous to S. pombe Cdc5p"
Sequence
MPPVPIYVKGGVWTNVEDQILKAAVQKYGTHQWSKVASLLQKKTARQSELRWNEYLNPKL
NFTEFSKEEDAQLLDLARELPNQWRTIADMMARPAQVCVERYNRLLESEDSGGAALSTGV
TDLKAGDINPNAETQMARPDNGDLEDEEKEMLAEARARLLNTQGKKATRKIRERMLEESK
RIAELQKRRELKQAGINVAIKKPKKKYGTDIDYNEDIVYEQAPMPGIYDTSTEDRQIKKK
FEQFERKVNRKGLDGNKDKPSKKNKDKKRKHDENEHVEKAALGESTTLTDEYKKPKLILS
APGTKQGKVTYKKKLESKRQKLIEAQATGTVLTPKELLPHDSGQEDNERSNIKSGKQLKS
RIRKFLVQMFASLPSPKNDFEIVLSEDEKEEDAEIAEYEKEFENERAMNEEDNFIEPPSQ
NDAPRVSLVAVPLAYSTLPIPEFKNNPQSAIDNKYNLLVANAINKEPHMVPEDTVDFLKE
VESRMQHITQGRTSMKIQFKTAMPPTEVLLESIQSKVESIEQLQRKLQHVQPLEQQNNEM
CSTLCHHSLPALIEGQRKYYADYYAYRQEIRSLEGRRKRLQAMLNSSSSI
Download sequence
Identical sequences E7KSY0 Q03654
5lj5.O 5lqw.W 5mps.O 5mq0.O YMR213W YMR213W 4932.YMR213W YMR213W YMR213W YMR213W YMR213W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]