SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR213W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR213W
Domain Number 1 Region: 9-92
Classification Level Classification E-value
Superfamily Homeodomain-like 1.03e-17
Family Myb/SANT domain 0.013
Further Details:      
 
Weak hits

Sequence:  YMR213W
Domain Number - Region: 551-586
Classification Level Classification E-value
Superfamily GreA transcript cleavage protein, N-terminal domain 0.0759
Family GreA transcript cleavage protein, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transcription factor complex 1.882 44.14
nucleoplasm part 1.418 35.16
SWI/SNF superfamily-type complex 2.178 21.43
chromosomal part 1.477 9.08
microtubule cytoskeleton 1.334 5.78
centrosome 1.806 5.78
nuclear chromosome 1.72 5.46
condensed chromosome 2.188 4.21
Biological Process IC (bits) H-Score
cell fate specification 2.06 47.51
cell fate commitment 1.396 44.66
neuron fate commitment 2.074 36.47
embryonic skeletal system development 1.617 35.67
diencephalon development 2.119 34.98
spinal cord development 2.206 32.75
gastrulation 1.44 32.28
mesoderm formation 1.807 32.28
RNA biosynthetic process 1.535 29.65
axis specification 1.742 26.85

Protein sequence

External link(s) Locus: YMR213W   Protein: S000004826
Sequence length 590
Comment CEF1 SGDID:S000004826, Chr XIII from 693380-695152, Verified ORF, "Essential splicing factor; associated with Prp19p and the spliceosome, contains an N-terminal c-Myb DNA binding motif necessary for cell viability but not for Prp19p association, evolutionarily conserved and homologous to S. pombe Cdc5p"
Sequence
MPPVPIYVKGGVWTNVEDQILKAAVQKYGTHQWSKVASLLQKKTARQSELRWNEYLNPKL
NFTEFSKEEDAQLLDLARELPNQWRTIADMMARPAQVCVERYNRLLESEDSGGAALSTGV
TDLKAGDINPNAETQMARPDNGDLEDEEKEMLAEARARLLNTQGKKATRKIRERMLEESK
RIAELQKRRELKQAGINVAIKKPKKKYGTDIDYNEDIVYEQAPMPGIYDTSTEDRQIKKK
FEQFERKVNRKGLDGNKDKPSKKNKDKKRKHDENEHVEKAALGESTTLTDEYKKPKLILS
APGTKQGKVTYKKKLESKRQKLIEAQATGTVLTPKELLPHDSGQEDNERSNIKSGKQLKS
RIRKFLVQMFASLPSPKNDFEIVLSEDEKEEDAEIAEYEKEFENERAMNEEDNFIEPPSQ
NDAPRVSLVAVPLAYSTLPIPEFKNNPQSAIDNKYNLLVANAINKEPHMVPEDTVDFLKE
VESRMQHITQGRTSMKIQFKTAMPPTEVLLESIQSKVESIEQLQRKLQHVQPLEQQNNEM
CSTLCHHSLPALIEGQRKYYADYYAYRQEIRSLEGRRKRLQAMLNSSSSI
Download sequence
Identical sequences E7KSY0 Q03654 W7QUQ1
YMR213W YMR213W YMR213W 4932.YMR213W YMR213W YMR213W YMR213W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]