SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR227C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YMR227C   Protein: S000004840
Sequence length 590
Comment TAF7 SGDID:S000004840, Chr XIII from 724384-722612, reverse complement, Verified ORF, "TFIID subunit (67 kDa), involved in RNA polymerase II transcription initiation"
Sequence
MAVIRIKKPRGPGEKDQPLEGEPKLKRIRIKTKVTDEDIKPKPKLKINLKKKKESADGKE
KKNSLKLKLNLKKNEEPVKKIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRI
LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRK
NLLKTFDVSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNG
APLSDMEAKHLKEIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQD
KQAEEVSYDLVDKSELQARQERVSSWENFKEEPGEPLSRPALKKEEIHTIASAVGKQGAE
EEGEEGMEEEEEEDLDLGAAFESEEEGSGAEGDKEQQQEEVGDEVDQDTGGEDDDDDDDG
DIEAAGGESESDDEKDENRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSIK
KLEKEAELKRKQLQQTEDSVQKQHQHRSDAETANNVEEEEEEEEEEEEEDEVDEDEEDDE
ENDEDEDNVHEREHIQENKVVRELDEAPAEETLDQNDLDMMMLFGAEGDE
Download sequence
Identical sequences E7QIL0 Q05021
YMR227C 4932.YMR227C YMR227C YMR227C YMR227C YMR227C IGBMC-1081-000 Pf-sce:YMR227C

Jump to [ Top of page · Domain architecture · Domain assignment details ]