SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR227C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR227C   Protein: S000004840
Sequence length 590
Comment TAF7 SGDID:S000004840, Chr XIII from 724384-722612, reverse complement, Verified ORF, "TFIID subunit (67 kDa), involved in RNA polymerase II transcription initiation"
Sequence
MAVIRIKKPRGPGEKDQPLEGEPKLKRIRIKTKVTDEDIKPKPKLKINLKKKKESADGKE
KKNSLKLKLNLKKNEEPVKKIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRI
LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRK
NLLKTFDVSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNG
APLSDMEAKHLKEIALKGYDYKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQD
KQAEEVSYDLVDKSELQARQERVSSWENFKEEPGEPLSRPALKKEEIHTIASAVGKQGAE
EEGEEGMEEEEEEDLDLGAAFESEEEGSGAEGDKEQQQEEVGDEVDQDTGGEDDDDDDDG
DIEAAGGESESDDEKDENRQHTELLADELNELETTLAHTKHKLSKATNPLLKSRFIDSIK
KLEKEAELKRKQLQQTEDSVQKQHQHRSDAETANNVEEEEEEEEEEEEEDEVDEDEEDDE
ENDEDEDNVHEREHIQENKVVRELDEAPAEETLDQNDLDMMMLFGAEGDE
Download sequence
Identical sequences E7QIL0 N1NZ16 Q05021
YMR227C 4932.YMR227C YMR227C IGBMC-1081-000 Pf-sce:YMR227C YMR227C YMR227C YMR227C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]