SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR230W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR230W-A   Protein: S000028576
Sequence length 62
Comment YMR230W-A SGDID:S000028576, Chr XIII from 733267-733455, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MCIIVKYSQCNLFFQDVLRCRHVLCMLFSIVVHFRLSSFVSVCGVRIMCNCINCSRFIHN
IN
Download sequence
Identical sequences A6ZMU3 B3LMB9 C7GRC0 C8ZF95 G2WKT8 Q3E7B5 W7PC70
YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A 4932.YMR230W-A SCRT_02125 YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A tr|A6ZMU3|A6ZMU3_YEAS7 YMR230W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]