SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR230W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YMR230W-A   Protein: S000028576
Sequence length 62
Comment YMR230W-A SGDID:S000028576, Chr XIII from 733267-733455, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MCIIVKYSQCNLFFQDVLRCRHVLCMLFSIVVHFRLSSFVSVCGVRIMCNCINCSRFIHN
IN
Download sequence
Identical sequences A6ZMU3 B3LMB9 C7GRC0 C8ZF95 G2WKT8 Q3E7B5 W7PC70
YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A 4932.YMR230W-A YMR230W-A SCRT_02125 YMR230W-A tr|A6ZMU3|A6ZMU3_YEAS7 YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A YMR230W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]