SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR231W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR231W
Domain Number 1 Region: 31-269
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.31e-13
Family WD40-repeat 0.023
Further Details:      
 
Domain Number 2 Region: 927-977
Classification Level Classification E-value
Superfamily RING/U-box 7.06e-08
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Protein sequence

External link(s) Locus: YMR231W   Protein: S000004844
Sequence length 1029
Comment PEP5 SGDID:S000004844, Chr XIII from 733544-736633, Verified ORF, "Component of CORVET tethering complex; peripheral vacuolar membrane protein required for protein trafficking and vacuole biogenesis; interacts with Pep7p"
Sequence
MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN
QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV
ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT
ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL
SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR
IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII
QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS
KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHVTLLLIVLIKLKDVEGIDTFIQHFDRK
GIWNEGVVMDDMDDVTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDI
LLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFE
VDLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTSDAMSESSEASHEHEEPTYHPPKPS
IVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERIDDW
RSRATGVLRESNKLVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIASFANDN
PEMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNKLIFKEMGGNEVLK
EKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTEIKRNEKLIESYDK
ELKEKNKKLKNTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHIYHQHCLNEEEDTL
ESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSRDRFKVITEFLGRG
AISYSDITI
Download sequence
Identical sequences B5VPZ9 P12868
YMR231W YMR231W 4932.YMR231W YMR231W YMR231W YMR231W

Jump to [ Top of page · Domain architecture · Domain assignment details ]