SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR231W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR231W
Domain Number 1 Region: 31-269
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000631
Family WD40-repeat 0.023
Further Details:      
 
Domain Number 2 Region: 927-977
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000706
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
integral component of plasma membrane 1.462 14.03
receptor complex 1.511 14.03
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic ribonucleoprotein granule 1.98 11.96
microbody 1.95 11.88

Protein sequence

External link(s) Locus: YMR231W   Protein: S000004844
Sequence length 1029
Comment PEP5 SGDID:S000004844, Chr XIII from 733544-736633, Verified ORF, "Component of CORVET tethering complex; peripheral vacuolar membrane protein required for protein trafficking and vacuole biogenesis; interacts with Pep7p"
Sequence
MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN
QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV
ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT
ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL
SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR
IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII
QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS
KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHVTLLLIVLIKLKDVEGIDTFIQHFDRK
GIWNEGVVMDDMDDVTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLIIVDI
LLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPSTFE
VDLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTSDAMSESSEASHEHEEPTYHPPKPS
IVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVPERIDDW
RSRATGVLRESNKLVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIASFANDN
PEMDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNKLIFKEMGGNEVLK
EKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTEIKRNEKLIESYDK
ELKEKNKKLKNTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHIYHQHCLNEEEDTL
ESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSRDRFKVITEFLGRG
AISYSDITI
Download sequence
Identical sequences B5VPZ9 N1NZ20 P12868
YMR231W YMR231W YMR231W YMR231W YMR231W 4932.YMR231W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]