SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR236W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR236W
Domain Number 1 Region: 30-101
Classification Level Classification E-value
Superfamily Histone-fold 1.44e-09
Family TBP-associated factors, TAFs 0.0092
Further Details:      
 

Protein sequence

External link(s) Locus: YMR236W   Protein: S000004849
Sequence length 157
Comment TAF9 SGDID:S000004849, Chr XIII from 742970-743443, Verified ORF, "Subunit (17 kDa) of TFIID and SAGA complexes, involved in RNA polymerase II transcription initiation and in chromatin modification, similar to histone H3"
Sequence
MNGGGKNVLNKNSVGSVSEVGPDSTQEETPRDVRLLHLLLASQSIHQYEDQVPLQLMDFA
HRYTQGVLKDALVYNDYAGSGNSAGSGLGVEDIRLAIAARTQYQFKPTAPKELMLQLAAE
RNKKALPQVMGTWGVRLPPEKYCLTAKEWDLEDPKSM
Download sequence
Identical sequences A6ZMU9 B3LMC5 C7GRB5 C8ZFA1 E7KGY2 E7KSZ6 E7LYX6 E7NLS3 E7Q858 E7QIL8 G2WKU4 H0GLD9 Q05027
YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W APC7026 YT72 YMR236W YMR236W YMR236W YMR236W 4932.YMR236W YMR236W SCRT_02131 YMR236W YMR236W tr|A6ZMU9|A6ZMU9_YEAS7 YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W

Jump to [ Top of page · Domain architecture · Domain assignment details ]