SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YMR236W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR236W
Domain Number 1 Region: 30-101
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000144
Family TBP-associated factors, TAFs 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.419 38.26
chromosomal part 1.478 32.11
transcription factor complex 1.881 31.3
DNA-directed RNA polymerase complex 2.004 27.86
SWI/SNF superfamily-type complex 2.177 23.8
lipid particle 1.519 21.32
nuclear chromosome 1.723 11.75
replication fork 2.197 11.75
condensed chromosome 2.187 9.51
methyltransferase complex 2.218 8.09

Protein sequence

External link(s) Locus: YMR236W   Protein: S000004849
Sequence length 157
Comment TAF9 SGDID:S000004849, Chr XIII from 742970-743443, Verified ORF, "Subunit (17 kDa) of TFIID and SAGA complexes, involved in RNA polymerase II transcription initiation and in chromatin modification, similar to histone H3"
Sequence
MNGGGKNVLNKNSVGSVSEVGPDSTQEETPRDVRLLHLLLASQSIHQYEDQVPLQLMDFA
HRYTQGVLKDALVYNDYAGSGNSAGSGLGVEDIRLAIAARTQYQFKPTAPKELMLQLAAE
RNKKALPQVMGTWGVRLPPEKYCLTAKEWDLEDPKSM
Download sequence
Identical sequences A6ZMU9 B3LMC5 C7GRB5 C8ZFA1 E7KGY2 E7KSZ6 E7LYX6 E7NLS3 E7Q858 E7QIL8 G2WKU4 H0GLD9 N1NZ24 Q05027 W7PYE6 W7RGA6
YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W YMR236W 4932.YMR236W YMR236W SCRT_02131 tr|A6ZMU9|A6ZMU9_YEAS7 YMR236W YMR236W APC7026 YT72 YMR236W YMR236W YMR236W YMR236W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]