SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR247W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR247W-A
Domain Number - Region: 4-45
Classification Level Classification E-value
Superfamily Coronavirus NSP7-like 0.00314
Family Coronavirus NSP7-like 0.006
Further Details:      
 

Protein sequence

External link(s) Locus: YMR247W-A   Protein: S000028849
Sequence length 47
Comment YMR247W-A SGDID:S000028849, Chr XIII from 769282-769425, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MAHKCASAKLLSGIMALLFNGKSLLRPICLHVHNHLVSNSDTNIVWP
Download sequence
Identical sequences A6ZMW4 B3LMD7 C8ZFB4 Q3E782 W7PMG7 W7RGB4
YMR247W-A YMR247W-A 4932.YMR247W-A YMR247W-A YMR247W-A SCRT_02144 YMR247W-A YMR247W-A tr|A6ZMW4|A6ZMW4_YEAS7 YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]