SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR247W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR247W-A
Domain Number - Region: 4-45
Classification Level Classification E-value
Superfamily Coronavirus NSP7-like 0.00314
Family Coronavirus NSP7-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR247W-A   Protein: S000028849
Sequence length 47
Comment YMR247W-A SGDID:S000028849, Chr XIII from 769282-769425, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MAHKCASAKLLSGIMALLFNGKSLLRPICLHVHNHLVSNSDTNIVWP
Download sequence
Identical sequences A6ZMW4 B3LMD7 C8ZFB4 Q3E782 W7PMG7 W7RGB4
YMR247W-A YMR247W-A YMR247W-A YMR247W-A tr|A6ZMW4|A6ZMW4_YEAS7 YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A YMR247W-A 4932.YMR247W-A SCRT_02144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]