SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR272C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR272C
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.14e-24
Family Cytochrome b5 0.0014
Further Details:      
 
Weak hits

Sequence:  YMR272C
Domain Number - Region: 259-332
Classification Level Classification E-value
Superfamily ADC synthase 0.0962
Family ADC synthase 0.012
Further Details:      
 

Protein sequence

External link(s) Locus: YMR272C   Protein: S000004885
Sequence length 384
Comment SCS7 SGDID:S000004885, Chr XIII from 810776-809622, reverse complement, Verified ORF, "Sphingolipid alpha-hydroxylase, functions in the alpha-hydroxylation of sphingolipid-associated very long chain fatty acids, has both cytochrome b5-like and hydroxylase/desaturase domains, not essential for growth"
Sequence
MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI
TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST
TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK
GSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE
YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF
ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT
SWFWDEVFGTYLGPDAPLSKMKYE
Download sequence
Identical sequences A6ZMY7 B3LMF9 C7GTM8 C8ZFD7 E7KGJ1 E7KT21 E7LZ02 E7Q7X4 G2WKY0 H0GLG7 Q03529
YMR272C YMR272C YMR272C YMR272C YMR272C YMR272C YMR272C 2384S YMR272C YMR272C 4932.YMR272C YMR272C SCRT_02167 YMR272C YMR272C tr|A6ZMY7|A6ZMY7_YEAS7 YMR272C YMR272C YMR272C YMR272C YMR272C YMR272C

Jump to [ Top of page · Domain architecture · Domain assignment details ]