SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR284W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR284W
Domain Number 1 Region: 265-574
Classification Level Classification E-value
Superfamily SPOC domain-like 1.31e-58
Family Ku70 subunit middle domain 0.02
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily vWA-like 1.48e-32
Family Ku70 subunit N-terminal domain 0.008
Further Details:      
 

Protein sequence

External link(s) Locus: YMR284W   Protein: S000004897
Sequence length 602
Comment YKU70 SGDID:S000004897, Chr XIII from 838186-839994, Verified ORF, "Subunit of the telomeric Ku complex (Yku70p-Yku80p), involved in telomere length maintenance, structure and telomere position effect; relocates to sites of double-strand cleavage to promote nonhomologous end joining during DSB repair"
Sequence
MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILE
SLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSS
GRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEA
QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEF
DGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK
LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKD
AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK
LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV
TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD
SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKEEKKPFDKKPKF
NI
Download sequence
Identical sequences B5VQ51 C7GTL5 C8ZFF1 P32807
YMR284W YMR284W 4932.YMR284W YMR284W YMR284W YMR284W YMR284W YMR284W YMR284W YMR284W

Jump to [ Top of page · Domain architecture · Domain assignment details ]