SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YMR284W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR284W
Domain Number 1 Region: 265-574
Classification Level Classification E-value
Superfamily SPOC domain-like 1.31e-58
Family Ku70 subunit middle domain 0.02
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily vWA-like 1.48e-32
Family Ku70 subunit N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
lyase activity 1.476 28.07
opsonin binding 2.119 25.91
integrin binding 1.752 22.25
proteoglycan binding 2.034 21.89
glycoprotein binding 1.559 19.69
anion transmembrane transporter activity 2.191 16.57
collagen binding 1.837 15.06
RNA binding 1.36 11.32
protein complex binding 1.49 10.48
metal ion transmembrane transporter activity 1.668 10.27
Cellular Component IC (bits) H-Score
integral to plasma membrane 1.469 42.46
external side of plasma membrane 1.923 26.29
secretory granule 1.827 18.67
clathrin-coated vesicle 1.877 18.67
cell projection membrane 1.528 13.23
membrane coat 2.107 11.96
nucleoplasm part 1.418 10.44
transcription factor complex 1.882 10.44
receptor complex 1.511 10.33
cytoplasmic vesicle part 1.738 10.27

Protein sequence

External link(s) Locus: YMR284W   Protein: S000004897
Sequence length 602
Comment YKU70 SGDID:S000004897, Chr XIII from 838186-839994, Verified ORF, "Subunit of the telomeric Ku complex (Yku70p-Yku80p), involved in telomere length maintenance, structure and telomere position effect; relocates to sites of double-strand cleavage to promote nonhomologous end joining during DSB repair"
Sequence
MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILE
SLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSS
GRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEA
QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEF
DGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK
LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKD
AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK
LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV
TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD
SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKEEKKPFDKKPKF
NI
Download sequence
Identical sequences B5VQ51 C7GTL5 C8ZFF1 N1P0Q2 P32807 W7PCC2
YMR284W YMR284W YMR284W YMR284W YMR284W 4932.YMR284W YMR284W YMR284W YMR284W YMR284W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]