SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR284W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR284W
Domain Number 1 Region: 265-574
Classification Level Classification E-value
Superfamily SPOC domain-like 1.31e-58
Family Ku70 subunit middle domain 0.02
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily vWA-like 1.48e-32
Family Ku70 subunit N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.462 42.57
external side of plasma membrane 1.827 26.76
side of membrane 1.701 23.41
transport vesicle 2.075 19.53
transferase complex 1.423 16.6
nucleoplasm part 1.496 16.6
transcription factor complex 1.912 16.6
collagen trimer 2.24 16.31
clathrin-coated vesicle 2.107 13.43
secretory granule 1.818 13.43
Molecular Function IC (bits) H-Score
lyase activity 1.474 28.14
opsonin binding 2.121 25.98
integrin binding 1.779 22.26
proteoglycan binding 2.036 21.94
cell adhesion molecule binding 1.514 20.65
glycoprotein binding 1.561 19.74
anion transmembrane transporter activity 2.24 15.64
RNA binding 1.324 11.35
inorganic cation transmembrane transporter activity 1.507 10.35
voltage-gated channel activity 2.085 10.35

Protein sequence

External link(s) Locus: YMR284W   Protein: S000004897
Sequence length 602
Comment YKU70 SGDID:S000004897, Chr XIII from 838186-839994, Verified ORF, "Subunit of the telomeric Ku complex (Yku70p-Yku80p), involved in telomere length maintenance, structure and telomere position effect; relocates to sites of double-strand cleavage to promote nonhomologous end joining during DSB repair"
Sequence
MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILE
SLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSS
GRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEA
QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEF
DGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK
LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKD
AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK
LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV
TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD
SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKEEKKPFDKKPKF
NI
Download sequence
Identical sequences B5VQ51 C7GTL5 C8ZFF1 N1P0Q2 P32807 W7PCC2
YMR284W YMR284W YMR284W 4932.YMR284W YMR284W YMR284W YMR284W YMR284W YMR284W YMR284W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]