SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR284W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR284W
Domain Number 1 Region: 265-574
Classification Level Classification E-value
Superfamily SPOC domain-like 1.31e-58
Family Ku70 subunit middle domain 0.02
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily vWA-like 1.48e-32
Family Ku70 subunit N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.428 46.05
membrane coat 2.044 31.99
transport vesicle membrane 2.03 28.67
coated vesicle membrane 2.075 26.65
Golgi-associated vesicle 2.091 26.55
transferase complex 1.369 21.48
nucleoplasm part 1.369 21.48
plasma membrane receptor complex 1.824 19.66
vesicle membrane 1.642 19.53
cytoplasmic vesicle part 1.417 15.85
Molecular Function IC (bits) H-Score
cytokine binding 1.952 20.65
lyase activity 1.408 16.55
metal ion transmembrane transporter activity 1.586 14.48
voltage-gated ion channel activity 1.945 14.48
DNA helicase activity 1.938 12.59
ATP-dependent helicase activity 1.974 11.4
growth factor binding 1.592 10.92
collagen binding 1.815 10.46
opsonin binding 2.121 9.88
calcium channel activity 2.037 9.73

Protein sequence

External link(s) Locus: YMR284W   Protein: S000004897
Sequence length 602
Comment YKU70 SGDID:S000004897, Chr XIII from 838186-839994, Verified ORF, "Subunit of the telomeric Ku complex (Yku70p-Yku80p), involved in telomere length maintenance, structure and telomere position effect; relocates to sites of double-strand cleavage to promote nonhomologous end joining during DSB repair"
Sequence
MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILE
SLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSS
GRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEA
QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEF
DGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK
LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKD
AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK
LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV
TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD
SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKEEKKPFDKKPKF
NI
Download sequence
Identical sequences A0A0L8VJ53 B5VQ51 C7GTL5 C8ZFF1 N1P0Q2 P32807
YMR284W YMR284W YMR284W YMR284W YMR284W YMR284W YMR284W 4932.YMR284W YMR284W YMR284W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]