SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR296C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR296C
Domain Number 1 Region: 143-457,496-547
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.19e-59
Family GABA-aminotransferase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.423 41.94
endoplasmic reticulum part 1.431 41.94
mitochondrial matrix 1.714 9.9
oxidoreductase complex 1.872 8.82
mitochondrial envelope 1.573 5.12
organelle inner membrane 1.669 4.89
microbody 1.95 4.39
plastid 1.6 3.84

Protein sequence

External link(s) Locus: YMR296C   Protein: S000004911
Sequence length 558
Comment LCB1 SGDID:S000004911, Chr XIII from 860890-859214, reverse complement, Verified ORF, "Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine"
Sequence
MAHIPEVLPKSIPIPAFIVTTSSYLWYYFNLVLTQIPGGQFIVSYIKKSHHDDPYRTTVE
IGLILYGIIYYLSKPQQKKSLQAQKPNLSPQEIDALIEDWEPEPLVDPSATDEQSWRVAK
TPVTMEMPIQNHITITRNNLQEKYTNVFNLASNNFLQLSATEPVKEVVKTTIKNYGVGAC
GPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSL
PVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDL
APLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGS
TGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSNNDAVQTLQKLSKSL
HDSFASDDSLRSYVIVTSSPVSAVLHLQLTPAYRSRKFGYTCEQLFETMSALQKKSQTNK
FIEPYEEEEKFLQSIVDHALINYNVLITRNTIVLKQETLPIVPSLKICCNAAMSPEELKN
ACESVKQSILACCQESNK
Download sequence
Identical sequences A6ZN12 B3LMI4 B5VQ63 C7GTK3 E7KGL9 E7NLV8 E7Q7Y7 E7QIT4 P25045 W7PMK0 W7R7H3
YMR296C tr|A6ZN12|A6ZN12_YEAS7 YMR296C YMR296c___KOG1358 YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C SCRT_02193 YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C 4932.YMR296C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]