SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR296C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR296C
Domain Number 1 Region: 143-457,496-547
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.19e-59
Family GABA-aminotransferase-like 0.00014
Further Details:      
 

Protein sequence

External link(s) Locus: YMR296C   Protein: S000004911
Sequence length 558
Comment LCB1 SGDID:S000004911, Chr XIII from 860890-859214, reverse complement, Verified ORF, "Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine"
Sequence
MAHIPEVLPKSIPIPAFIVTTSSYLWYYFNLVLTQIPGGQFIVSYIKKSHHDDPYRTTVE
IGLILYGIIYYLSKPQQKKSLQAQKPNLSPQEIDALIEDWEPEPLVDPSATDEQSWRVAK
TPVTMEMPIQNHITITRNNLQEKYTNVFNLASNNFLQLSATEPVKEVVKTTIKNYGVGAC
GPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSL
PVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDL
APLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGS
TGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSNNDAVQTLQKLSKSL
HDSFASDDSLRSYVIVTSSPVSAVLHLQLTPAYRSRKFGYTCEQLFETMSALQKKSQTNK
FIEPYEEEEKFLQSIVDHALINYNVLITRNTIVLKQETLPIVPSLKICCNAAMSPEELKN
ACESVKQSILACCQESNK
Download sequence
Identical sequences A6ZN12 B3LMI4 B5VQ63 C7GTK3 E7KGL9 E7NLV8 E7Q7Y7 E7QIT4 P25045
YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C YMR296C 4932.YMR296C YMR296C SCRT_02193 YMR296C YMR296C tr|A6ZN12|A6ZN12_YEAS7 YMR296C YMR296C YMR296c___KOG1358 YMR296C YMR296C YMR296C

Jump to [ Top of page · Domain architecture · Domain assignment details ]