SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YMR300C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR300C
Domain Number 1 Region: 260-485
Classification Level Classification E-value
Superfamily PRTase-like 3.28e-64
Family Phosphoribosyltransferases (PRTases) 0.000000764
Further Details:      
 
Domain Number 2 Region: 2-241
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.95e-63
Family Class II glutamine amidotransferases 0.000000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external side of plasma membrane 1.922 22.25
ribonucleoprotein complex 1.415 6.89
extracellular organelle 1.592 4.91
ribonucleoprotein granule 1.998 4.32
cytosol 1.305 4.26

Protein sequence

External link(s) Locus: YMR300C   Protein: S000004915
Sequence length 510
Comment ADE4 SGDID:S000004915, Chr XIII from 867090-865558, reverse complement, Verified ORF, "Phosphoribosylpyrophosphate amidotransferase (PRPPAT; amidophosphoribosyltransferase), catalyzes first step of the 'de novo' purine nucleotide biosynthetic pathway"
Sequence
MCGILGIVLANQTTPVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCKGNGMARDVFT
QQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGINLAHNGNLVNTASLKRYMDE
DVHRHINTDSDSELLLNIFAAELEKHNKYRVNNEDVFHALEGVYRLCRGGYACVGLLAGF
ALFGFRDPNGIRPLLFGERENPDGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNC
SKGEPEFKQVVPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKPE
DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERVSSVRRKLNPM
ESEFKGKKVLIVDDSIVRGTTSKEIVNMAKESGATKVYFASAAPAIRYNHIYGIDLTDTK
NLIAYNRTDEEVAEVIGCERVIYQSLEDLIDCCKTDKITKFEDGVFTGNYVTGVEDGYIQ
ELEEKRESIANNSSDMKAEVDIGLYNCADY
Download sequence
Identical sequences A6ZN16 B3LMI8 B5VQ66 C7GTJ9 E7KGM1 E7KT41 E7LZ11 E7Q7Y9 E7QIT8 G2WL09 N1P632 P04046 W7PF49 W7QXN5
4932.YMR300C SCRT_02197 YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C tr|A6ZN16|A6ZN16_YEAS7 YMR300C YMR300C YMR300C YMR300C YMR300C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]