SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR300C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR300C
Domain Number 1 Region: 260-485
Classification Level Classification E-value
Superfamily PRTase-like 3.28e-64
Family Phosphoribosyltransferases (PRTases) 7.64e-07
Further Details:      
 
Domain Number 2 Region: 2-241
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.95e-63
Family Class II glutamine amidotransferases 7.47e-07
Further Details:      
 

Protein sequence

External link(s) Locus: YMR300C   Protein: S000004915
Sequence length 510
Comment ADE4 SGDID:S000004915, Chr XIII from 867090-865558, reverse complement, Verified ORF, "Phosphoribosylpyrophosphate amidotransferase (PRPPAT; amidophosphoribosyltransferase), catalyzes first step of the 'de novo' purine nucleotide biosynthetic pathway"
Sequence
MCGILGIVLANQTTPVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCKGNGMARDVFT
QQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGINLAHNGNLVNTASLKRYMDE
DVHRHINTDSDSELLLNIFAAELEKHNKYRVNNEDVFHALEGVYRLCRGGYACVGLLAGF
ALFGFRDPNGIRPLLFGERENPDGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNC
SKGEPEFKQVVPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKPE
DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERVSSVRRKLNPM
ESEFKGKKVLIVDDSIVRGTTSKEIVNMAKESGATKVYFASAAPAIRYNHIYGIDLTDTK
NLIAYNRTDEEVAEVIGCERVIYQSLEDLIDCCKTDKITKFEDGVFTGNYVTGVEDGYIQ
ELEEKRESIANNSSDMKAEVDIGLYNCADY
Download sequence
Identical sequences A6ZN16 B3LMI8 B5VQ66 C7GTJ9 E7KGM1 E7KT41 E7LZ11 E7Q7Y9 E7QIT8 G2WL09 P04046
YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C 4932.YMR300C YMR300C SCRT_02197 YMR300C YMR300C tr|A6ZN16|A6ZN16_YEAS7 YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C YMR300C

Jump to [ Top of page · Domain architecture · Domain assignment details ]