SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR314W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR314W
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 8.96e-66
Family Proteasome subunits 9.16e-10
Further Details:      
 

Protein sequence

External link(s) Locus: YMR314W   Protein: S000004931
Sequence length 234
Comment PRE5 SGDID:S000004931, Chr XIII from 901708-902412, Verified ORF, "Alpha 6 subunit of the 20S proteasome"
Sequence
MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQ
KKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNT
QSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFI
KIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI
Download sequence
Identical sequences A6ZN31 B3LMK2 B5VQ80 C7GPU9 C8ZFI5 E7KGP2 E7KT51 E7LZ20 E7NLX0 E7QIU9 G2WL23 H0GLK5 N1P645 P40302 W7PYM9 W7RA10
YMR314W 2zcyE YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W 4932.YMR314W YMR314W YMR314W SCRT_02211 YMR314W YMR314W tr|A6ZN31|A6ZN31_YEAS7 YMR314W 1fnt.F 1fnt.T 1vsy.F 1vsy.T 1z7q.F 1z7q.T 2zcy.E 2zcy.S 3bdm.E 3bdm.S 3l5q.K 3l5q.W 3mg6.E 3mg6.S 3mg7.E 3mg7.S 3mg8.E 3mg8.S 3nzj.E 3nzj.S 3nzw.E 3nzw.S 3nzx.E 3nzx.S 3un4.E 3un4.S 3un8.E 3un8.S 4b4t.F 4g4s.F 4inr.E 4inr.S 4int.E 4int.S 4inu.E 4inu.S YMR314W YMR314W YMR314W YMR314W YMR314W YMR314W

Jump to [ Top of page · Domain architecture · Domain assignment details ]