SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR318C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR318C
Domain Number 1 Region: 7-185
Classification Level Classification E-value
Superfamily GroES-like 7e-48
Family Alcohol dehydrogenase-like, N-terminal domain 0.0000000439
Further Details:      
 
Domain Number 2 Region: 154-320
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.87e-37
Family Alcohol dehydrogenase-like, C-terminal domain 0.000000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.462 17.2
cilium 1.573 15.5
ciliary part 1.844 15.5
microbody 1.95 12.45
axon 1.505 9.57
synapse part 1.451 9.57
oxidoreductase complex 1.872 8.62
cation channel complex 2.046 7.93
Golgi membrane 1.613 7.27
intrinsic component of organelle membrane 2.09 7.27

Protein sequence

External link(s) Locus: YMR318C   Protein: S000004937
Sequence length 360
Comment ADH6 SGDID:S000004937, Chr XIII from 912141-911059, reverse complement, Verified ORF, "NADPH-dependent medium chain alcohol dehydrogenase with broad substrate specificity; member of the cinnamyl family of alcohol dehydrogenases; may be involved in fusel alcohol synthesis or in aldehyde tolerance"
Sequence
MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNM
KMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTT
YSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPG
KKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKY
FDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSA
LGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD
Download sequence
Identical sequences A6ZN36 B3LMK7 B5VQ85 C7GPU5 E7KGP5 E7KT55 E7NLX3 G2WL30 N1NYX0 Q04894 W7PF70 W7RA21
SCRT_02216 YMR318C YMR318C YMR318C 1piw.A 1piw.B 1ps0.A 1q1n.A YMR318C 4932.YMR318C YMR318C YMR318C YMR318C YMR318C YMR318C YMR318C YMR318C YMR318C 1piwA YMR318C YMR318C YMR318C tr|A6ZN36|A6ZN36_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]