SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL002C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL002C
Domain Number 1 Region: 141-285
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 1.26e-29
Family Ribosomal protein L30p/L7e 0.0079
Further Details:      
 

Protein sequence

External link(s) Locus: YNL002C   Protein: S000004947
Sequence length 322
Comment RLP7 SGDID:S000004947, Chr XIV from 627144-626176, reverse complement, Verified ORF, "Nucleolar protein with similarity to large ribosomal subunit L7 proteins; constituent of 66S pre-ribosomal particles; plays an essential role in processing of precursors to the large ribosomal subunit RNAs"
Sequence
MSSTQDSKAQTLNSNPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAES
IVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEKANGAEENSVDLEET
EEEEDDGLIREKTTYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLT
KNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIVEEQLG
DHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNRLRKIKQREAESRTRQ
FSNAATAPVIEVDIDSLLAKLN
Download sequence
Identical sequences B3LPP0 C8ZFM4 E7KTQ3 E7QK36 H0GMS4 N1NZN2 P40693 W7QTE6
YNL002C YNL002C 4932.YNL002C YNL002C YNL002C SCRT_03143 YNL002C YNL002C YNL002C YNL002C YNL002C YNL002C

Jump to [ Top of page · Domain architecture · Domain assignment details ]