SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL002C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL002C
Domain Number 1 Region: 141-285
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 1.26e-29
Family Ribosomal protein L30p/L7e 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribosomal subunit 1.983 43.73
cytosol 1.295 27.72
intracellular ribonucleoprotein complex 1.368 25.6
organellar ribosome 2.107 11.07
mitochondrial matrix 1.611 4.97
cytosolic ribosome 2.235 4.33
Biological Process IC (bits) H-Score
translation 1.514 22.59
ribosome biogenesis 1.853 18.35
ribonucleoprotein complex biogenesis 1.7 15.69
rRNA metabolic process 2.071 11.11
RNA processing 1.499 8.05
ncRNA processing 1.837 8.05
ncRNA metabolic process 1.491 6.15
ribonucleoprotein complex assembly 1.922 4.2
Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.959 37.39

Protein sequence

External link(s) Locus: YNL002C   Protein: S000004947
Sequence length 322
Comment RLP7 SGDID:S000004947, Chr XIV from 627144-626176, reverse complement, Verified ORF, "Nucleolar protein with similarity to large ribosomal subunit L7 proteins; constituent of 66S pre-ribosomal particles; plays an essential role in processing of precursors to the large ribosomal subunit RNAs"
Sequence
MSSTQDSKAQTLNSNPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAES
IVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEKANGAEENSVDLEET
EEEEDDGLIREKTTYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLT
KNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIVEEQLG
DHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNRLRKIKQREAESRTRQ
FSNAATAPVIEVDIDSLLAKLN
Download sequence
Identical sequences A0A0L8VIV3 B3LPP0 C8ZFM4 E7KTQ3 E7QK36 H0GMS4 N1NZN2 P40693
YNL002C 4932.YNL002C YNL002C YNL002C YNL002C YNL002C 3jct.t 4v7f.r 4v7f.s YNL002C YNL002C YNL002C YNL002C YNL002C 001148108|e3j65r1|887.1.1.1|r:1-322 001284052|e3j66s1|887.1.1.1|s:1-322 001438174|e4v7fr1|887.1.1.1|r:1-322 001438175|e4v7fs1|887.1.1.1|s:1-322 SCRT_03143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]