SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL002C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL002C
Domain Number 1 Region: 141-285
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 1.26e-29
Family Ribosomal protein L30p/L7e 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
translation 1.516 11.11
RNA processing 1.497 9.77
rRNA metabolic process 2.134 9.53
ribosome biogenesis 1.945 8.11
ncRNA processing 1.821 6.52
ncRNA metabolic process 1.499 4.99
mitochondrion organization 1.534 4.45
Cellular Component IC (bits) H-Score
ribosomal subunit 1.948 45.16
intracellular ribonucleoprotein complex 1.323 25.37
cytosolic part 1.678 14.63
cytosolic ribosome 2.062 12.06
mitochondrial ribosome 2.079 10.27
mitochondrial matrix 1.568 4.79
Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.965 30.44

Protein sequence

External link(s) Locus: YNL002C   Protein: S000004947
Sequence length 322
Comment RLP7 SGDID:S000004947, Chr XIV from 627144-626176, reverse complement, Verified ORF, "Nucleolar protein with similarity to large ribosomal subunit L7 proteins; constituent of 66S pre-ribosomal particles; plays an essential role in processing of precursors to the large ribosomal subunit RNAs"
Sequence
MSSTQDSKAQTLNSNPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAES
IVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEKANGAEENSVDLEET
EEEEDDGLIREKTTYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLT
KNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIVEEQLG
DHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNRLRKIKQREAESRTRQ
FSNAATAPVIEVDIDSLLAKLN
Download sequence
Identical sequences B3LPP0 C8ZFM4 E7KTQ3 E7QK36 H0GMS4 N1NZN2 P40693 W7QTE6
YNL002C YNL002C YNL002C YNL002C YNL002C 4932.YNL002C YNL002C YNL002C YNL002C 3j65.r 3j66.s YNL002C SCRT_03143 YNL002C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]