SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL009W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL009W
Domain Number 1 Region: 1-407
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.04e-143
Family Dimeric isocitrate & isopropylmalate dehydrogenases 2.11e-10
Further Details:      
 

Protein sequence

External link(s) Locus: YNL009W   Protein: S000004954
Sequence length 420
Comment IDP3 SGDID:S000004954, Chr XIV from 614822-616084, Verified ORF, "Peroxisomal NADP-dependent isocitrate dehydrogenase, catalyzes oxidation of isocitrate to alpha-ketoglutarate with the formation of NADP(H+), required for growth on unsaturated fatty acids"
Sequence
MSKIKVVHPIVEMDGDEQTRVIWKLIKEKLILPYLDVDLKYYDLSIQERDRTNDQVTKDS
SYATLKYGVAVKCATITPDEARMKEFNLKEMWKSPNGTIRNILGGTVFREPIIIPKIPRL
VPHWEKPIIIGRHAFGDQYRATDIKIKKAGKLRLQFSSDDGKENIDLKVYEFPKSGGIAM
AMFNTNDSIKGFAKASFELALKRKLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQ
ALKITYEHRLIDDMVAQMLKSKGGFIIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDG
KTFESEAAHGTVTRHFRKHQRGEETSTNSIASIFAWTRAIIQRGKLDNTDDVIKFGNLLE
KATLDTVQVGGKMTKDLALMLGKTNRSSYVTTEEFIDEVAKRLQNMMLSSNEDKKGMCKL
Download sequence
Identical sequences P53982
YNL009W YNL009W 4932.YNL009W YNL009W YNL009W YNL009W

Jump to [ Top of page · Domain architecture · Domain assignment details ]