SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL009W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL009W
Domain Number 1 Region: 1-407
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.04e-143
Family Dimeric isocitrate & isopropylmalate dehydrogenases 0.000000000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
mitochondrial matrix 1.714 7.72
microtubule cytoskeleton 1.341 7.56
microtubule associated complex 1.998 7.56
lipid particle 1.469 6.51
plastid 1.6 6.34
chloroplast part 1.896 6.34
plastid stroma 2.025 6.24
oxidoreductase complex 1.872 6.05
microbody 1.95 4.66

Protein sequence

External link(s) Locus: YNL009W   Protein: S000004954
Sequence length 420
Comment IDP3 SGDID:S000004954, Chr XIV from 614822-616084, Verified ORF, "Peroxisomal NADP-dependent isocitrate dehydrogenase, catalyzes oxidation of isocitrate to alpha-ketoglutarate with the formation of NADP(H+), required for growth on unsaturated fatty acids"
Sequence
MSKIKVVHPIVEMDGDEQTRVIWKLIKEKLILPYLDVDLKYYDLSIQERDRTNDQVTKDS
SYATLKYGVAVKCATITPDEARMKEFNLKEMWKSPNGTIRNILGGTVFREPIIIPKIPRL
VPHWEKPIIIGRHAFGDQYRATDIKIKKAGKLRLQFSSDDGKENIDLKVYEFPKSGGIAM
AMFNTNDSIKGFAKASFELALKRKLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQ
ALKITYEHRLIDDMVAQMLKSKGGFIIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDG
KTFESEAAHGTVTRHFRKHQRGEETSTNSIASIFAWTRAIIQRGKLDNTDDVIKFGNLLE
KATLDTVQVGGKMTKDLALMLGKTNRSSYVTTEEFIDEVAKRLQNMMLSSNEDKKGMCKL
Download sequence
Identical sequences N1NWR1 P53982
YNL009W YNL009W YNL009W 4932.YNL009W YNL009W YNL009W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]