SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL018C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNL018C   Protein: S000004963
Sequence length 612
Comment YNL018C SGDID:S000004963, Chr XIV from 601775-599937, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MSTSFQEFKAFCNKVGLDFQWLNLQSSKSVPENGSSEGFSAVSDTVQENIRPATEPLNVN
QSKDPVSNFFYDVKNAPLWNVYKRNHSGHSSAEACSGVSSRQAPKNIPEAMVKETVLSNH
DNVTIINELLPTSSAMHQEESTAMTTSYLLSHSVNDTCNVMFSSSSHNRAMLPSSLVQRN
NATTSPTTDSASENNESVPSLTSSVSTSSSVYSSWNPPHSPHISSFPDGNFASLNAEVTC
FDFRRTKDSRTKETNESIIPTEIYCPTNSTDHHKHYPSRKSKQDACAPAPCNQNISCSVV
STAEFSQSNHTLTTVVPSYMQQYLDRPQNWFESKMGKYCPLFLRSTKNIDYDSLEFKFER
KMIAVQYLLLDEQSEPRRYYNPSNKSIPFWKRPFNFDTMPSYDQLMEEAECRFYSYQYKY
EGFQRIEPYSISCPWKNTQREIDLVLDHIHFSLDVGEKKSLNRKGNITLDTLDSKVDPNI
QIKPYQIFPSNNLVYEGLPHPAEQSLILSPDTSLIERAFQALIDICKESIPSSNDCSTRN
NNSAPQLTVPEPSKPCRLLLVRESRTATELKTNKKLWLHSQRRNIEVTVPMHPSERGTKS
WLRKWLSTFVHQ
Download sequence
Identical sequences P53976
YNL018C YNL018C 4932.YNL018C YNL018C YNL018C YNL018C YNL018C

Jump to [ Top of page · Domain architecture · Domain assignment details ]