SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL018C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL018C   Protein: S000004963
Sequence length 612
Comment YNL018C SGDID:S000004963, Chr XIV from 601775-599937, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MSTSFQEFKAFCNKVGLDFQWLNLQSSKSVPENGSSEGFSAVSDTVQENIRPATEPLNVN
QSKDPVSNFFYDVKNAPLWNVYKRNHSGHSSAEACSGVSSRQAPKNIPEAMVKETVLSNH
DNVTIINELLPTSSAMHQEESTAMTTSYLLSHSVNDTCNVMFSSSSHNRAMLPSSLVQRN
NATTSPTTDSASENNESVPSLTSSVSTSSSVYSSWNPPHSPHISSFPDGNFASLNAEVTC
FDFRRTKDSRTKETNESIIPTEIYCPTNSTDHHKHYPSRKSKQDACAPAPCNQNISCSVV
STAEFSQSNHTLTTVVPSYMQQYLDRPQNWFESKMGKYCPLFLRSTKNIDYDSLEFKFER
KMIAVQYLLLDEQSEPRRYYNPSNKSIPFWKRPFNFDTMPSYDQLMEEAECRFYSYQYKY
EGFQRIEPYSISCPWKNTQREIDLVLDHIHFSLDVGEKKSLNRKGNITLDTLDSKVDPNI
QIKPYQIFPSNNLVYEGLPHPAEQSLILSPDTSLIERAFQALIDICKESIPSSNDCSTRN
NNSAPQLTVPEPSKPCRLLLVRESRTATELKTNKKLWLHSQRRNIEVTVPMHPSERGTKS
WLRKWLSTFVHQ
Download sequence
Identical sequences P53976
4932.YNL018C YNL018C YNL018C YNL018C YNL018C YNL018C YNL018C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]