SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL026W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNL026W   Protein: S000004971
Sequence length 484
Comment SAM50 SGDID:S000004971, Chr XIV from 581921-583375, Verified ORF, "Essential component of the Sorting and Assembly Machinery (SAM or Tob complex) of the mitochondrial outer membrane, which binds precursors of beta-barrel proteins and facilitates their outer membrane insertion; homologous to bacterial Omp85"
Sequence
MTSSSGVDNEISLDSPMPIFNESSTLKPIRVAGVVTTGTDHIDPSVLQAYLDDTIMKSIT
LGQLVKNADVLNKRLCQHHIALNAKQSFHFQGNTYISDEKETHDVVPLMEVVSQLDILPP
KTFTAKTGTNFGNDNDAEAYLQFEKLIDKKYLKLPTRVNLEILRGTKIHSSFLFNSYSSL
SPQSILNLKVFSQFYNWNTNKGLDIGQRGARLSLRYEPLFLHKLLHNPHSNESPTLFHEW
FLETCWRSTKICSQGTSAPYMYSGTMLSQAGDQLRTILGHTFVLDKRDHIMCPTKGSMLK
WSNELSPGKHLKTQLELNSVKSWMNDDFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSG
GPSDIRGFQTFGLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLV
NHDNTSLGNCIGQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDLIRKGFQFGLG
LAFL
Download sequence
Identical sequences A6ZS53 B5VR11 E9P977 G2WM78 P53969
YNL026W 4932.YNL026W YNL026W YNL026W YNL026W YNL026W YNL026W tr|A6ZS53|A6ZS53_YEAS7 YNL026W YR37 YNL026W YNL026W YNL026W

Jump to [ Top of page · Domain architecture · Domain assignment details ]