SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YNL026W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL026W   Protein: S000004971
Sequence length 484
Comment SAM50 SGDID:S000004971, Chr XIV from 581921-583375, Verified ORF, "Essential component of the Sorting and Assembly Machinery (SAM or Tob complex) of the mitochondrial outer membrane, which binds precursors of beta-barrel proteins and facilitates their outer membrane insertion; homologous to bacterial Omp85"
Sequence
MTSSSGVDNEISLDSPMPIFNESSTLKPIRVAGVVTTGTDHIDPSVLQAYLDDTIMKSIT
LGQLVKNADVLNKRLCQHHIALNAKQSFHFQGNTYISDEKETHDVVPLMEVVSQLDILPP
KTFTAKTGTNFGNDNDAEAYLQFEKLIDKKYLKLPTRVNLEILRGTKIHSSFLFNSYSSL
SPQSILNLKVFSQFYNWNTNKGLDIGQRGARLSLRYEPLFLHKLLHNPHSNESPTLFHEW
FLETCWRSTKICSQGTSAPYMYSGTMLSQAGDQLRTILGHTFVLDKRDHIMCPTKGSMLK
WSNELSPGKHLKTQLELNSVKSWMNDDFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSG
GPSDIRGFQTFGLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLV
NHDNTSLGNCIGQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDLIRKGFQFGLG
LAFL
Download sequence
Identical sequences A6ZS53 B5VR11 E9P977 G2WM78 N1NWQ0 P53969
YNL026W tr|A6ZS53|A6ZS53_YEAS7 YNL026W YNL026W YNL026W YNL026W YNL026W YNL026W YR37 YNL026W 4932.YNL026W YNL026W YNL026W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]