SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL041C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL041C   Protein: S000004986
Sequence length 839
Comment COG6 SGDID:S000004986, Chr XIV from 551988-549469, reverse complement, Verified ORF, "Component of the conserved oligomeric Golgi complex (Cog1p through Cog8p), a cytosolic tethering complex that functions in protein trafficking to mediate fusion of transport vesicles to Golgi compartments"
Sequence
MDFVVDYQTYAMADTATPELPEPEPRLNLTSDAQSQPTGKLDLQFKLPDLQRYSNNNATL
PVDNDGAGSKDLHKKMTHYAMSSIDKIQLSNPSKQLGQNSQDEKLSQQESQNFTNYEPKN
LDLSKLVSPSSGSNKNTTNLVLSNKLSKILNNYTLINYQATVQLRKSLKVLEENKERLSL
DEQKLMNPEYVGTLARRALRTDLESQLLKEHITVLEEFKPIIRRIKRLSSSVEKIQRTSE
KLLSNETNEVPTNNVVLQEIDQYRLKAEQLKLKKKILLSIRDRFTLNQVEDDVITNGTID
NIFFEVVKKVINIKDESSFLLTLPNLNAGNALIMGVNEILEKTNKKIFNYLIDFLYSFES
SSNLLNDHGTTEQESLNIFRKSLVFLSSDLELFNELLKRVTTLRSKSILDEFLSQFDMNS
TTSKPIILSAHDPIRYIGDVLASVHSIIANEADFVKSLFDFQDEDLKDTPISILQQNKTF
LKGIDNKLLNDIIQSLSNSCRIRIEQIVRFEENPIINFEIVRLLKLYRVMFERKGIQDDS
SIINNLKSLEDISKNRIIGYYEDYMKQTVMAETKNSSDDLLPPEWLSEYMNKLVELFEIY
EKTHAAEDEESEDNKLLSSKNLQTIVEQPIKDVLLKQLQTSFPLAKKNEKEKASLLTIEI
NCFDLIKSRLQPFEGLFAQDDDSRKITIWVCDKLKEYTKQMLTLQIKFLFENTGLDLYSN
LVNMIFPVDSVKDELDYDMYLALRDNSLMELDMVRKNVHDKLNYYLPQALTDVQGNLLFK
LTSPMIADEICDECFKKLSLFYNIFRKLLIHLYPNKKDQVFEILNFSTDEFDMLIGIDH
Download sequence
Identical sequences G2WM62 N1NY18 P53959
YNL041C YNL041C 4932.YNL041C YNL041C YNL041C YNL041C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]