SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL048W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL048W
Domain Number 1 Region: 76-436,465-532
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.26e-33
Family Glycosyl transferases group 1 0.023
Further Details:      
 

Protein sequence

External link(s) Locus: YNL048W   Protein: S000004993
Sequence length 548
Comment ALG11 SGDID:S000004993, Chr XIV from 538174-539820, Verified ORF, "Alpha-1,2-mannosyltransferase, catalyzes sequential addition of the two terminal alpha 1,2-mannose residues to the Man5GlcNAc2-PP-dolichol intermediate during asparagine-linked glycosylation in the ER"
Sequence
MGSAWTNYNFEEVKSHFGFKKYVVSSLVLVYGLIKVLTWIFRQWVYSSLNPFSKKSSLLN
RAVASCGEKNVKVFGFFHPYCNAGGGGEKVLWKAVDITLRKDAKNVIVIYSGDFVNGENV
TPENILNNVKAKFDYDLDSDRIFFISLKLRYLVDSSTWKHFTLIGQAIGSMILAFESIIQ
CPPDIWIDTMGYPFSYPIIARFLRRIPIVTYTHYPIMSKDMLNKLFKMPKKGIKVYGKIL
YWKVFMLIYQSIGSKIDIVITNSTWTNNHIKQIWQSNTCKIIYPPCSTEKLVDWKQKFGT
AKGERLNQAIVLAQFRPEKRHKLIIESFATFLKNLPDSVSPIKLIMAGSTRSKQDENYVK
SLQDWSENVLKIPKHLISFEKNLPFDKIEILLNKSTFGVNAMWNEHFGIAVVEYMASGLI
PIVHASAGPLLDIVTPWDANGNIGKAPPQWELQKKYFAKLEDDGETTGFFFKEPSDPDYN
TTKDPLRYPNLSDLFLQITKLDYDCLRVMGARNQQYSLYKFSDLKFDKDWENFVLNPICK
LLEEEERG
Download sequence
Identical sequences C7GLV2 C8ZGI0 N1NWN8 P53954
YNL048W YNL048W 4932.YNL048W YNL048W YNL048W YNL048W YNL048W

Jump to [ Top of page · Domain architecture · Domain assignment details ]