SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL048W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL048W
Domain Number 1 Region: 76-436,465-532
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.26e-33
Family Glycosyl transferases group 1 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transferase activity, transferring hexosyl groups 2.227 154.68
phosphoric ester hydrolase activity 1.596 43.44
isomerase activity 1.67 37.67
monocarboxylic acid binding 1.998 13.14
carbohydrate binding 1.687 7.45
carboxylic acid binding 1.481 6.85
drug binding 2.131 3.94
Cellular Component IC (bits) H-Score
transferase complex 1.423 43.5
external encapsulating structure 1.632 8.12
plastid 1.6 7.79
outer membrane 2.24 7.79
nuclear outer membrane-endoplasmic reticulum membrane network 1.557 7.44
endoplasmic reticulum part 1.431 6.72
chloroplast part 1.896 6.08

Protein sequence

External link(s) Locus: YNL048W   Protein: S000004993
Sequence length 548
Comment ALG11 SGDID:S000004993, Chr XIV from 538174-539820, Verified ORF, "Alpha-1,2-mannosyltransferase, catalyzes sequential addition of the two terminal alpha 1,2-mannose residues to the Man5GlcNAc2-PP-dolichol intermediate during asparagine-linked glycosylation in the ER"
Sequence
MGSAWTNYNFEEVKSHFGFKKYVVSSLVLVYGLIKVLTWIFRQWVYSSLNPFSKKSSLLN
RAVASCGEKNVKVFGFFHPYCNAGGGGEKVLWKAVDITLRKDAKNVIVIYSGDFVNGENV
TPENILNNVKAKFDYDLDSDRIFFISLKLRYLVDSSTWKHFTLIGQAIGSMILAFESIIQ
CPPDIWIDTMGYPFSYPIIARFLRRIPIVTYTHYPIMSKDMLNKLFKMPKKGIKVYGKIL
YWKVFMLIYQSIGSKIDIVITNSTWTNNHIKQIWQSNTCKIIYPPCSTEKLVDWKQKFGT
AKGERLNQAIVLAQFRPEKRHKLIIESFATFLKNLPDSVSPIKLIMAGSTRSKQDENYVK
SLQDWSENVLKIPKHLISFEKNLPFDKIEILLNKSTFGVNAMWNEHFGIAVVEYMASGLI
PIVHASAGPLLDIVTPWDANGNIGKAPPQWELQKKYFAKLEDDGETTGFFFKEPSDPDYN
TTKDPLRYPNLSDLFLQITKLDYDCLRVMGARNQQYSLYKFSDLKFDKDWENFVLNPICK
LLEEEERG
Download sequence
Identical sequences C7GLV2 C8ZGI0 N1NWN8 P53954
YNL048W YNL048W YNL048W YNL048W 4932.YNL048W YNL048W YNL048W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]