SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL054W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YNL054W-A
Domain Number - Region: 68-173
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0128
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 
Domain Number - Region: 222-302
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0706
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL054W-A   Protein: S000007384
Sequence length 440
Comment YNL054W-A SGDID:S000007384, Chr XIV from 519457-520779, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENPHHASPQTAQSHSPQNGPYPQQCMMTQNQANPSDWSFYGRPSMIPYTPYQMSPM
YFPPGPHSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FLNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNPSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPETY
Download sequence
Identical sequences Q12470
YNL054W-A 4932.YNL054W-A YNL054W-A YNL054W-A YNL054W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]