SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL096C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNL096C   Protein: S000005040
Sequence length 190
Comment RPS7B SGDID:S000005040, Chr XIV from 444317-444174,443828-443400, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps7Ap; interacts with Kti11p; deletion causes hypersensitivity to zymocin; has similarity to rat S7 and Xenopus S8 ribosomal proteins"
Sequence
MSSVQSKILSQAPSELELQVAKTFIDLESSSPELKADLRPLQIKSIREIDVTGGKKALVL
FVPVPALSAYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPSRTSRQVQKRPRSRTLTA
VHDKVLEDMVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQIDYKLESFQAVYNKLTGKQ
IVFEIPSQTN
Download sequence
Identical sequences A6ZRY5 B3LNV4 C8ZGD5 G2WM09 P48164
YNL096C YNL096C YNL096C YNL096C YNL096C YNL096C YNL096C YNL096C YNL096C YT180 YNL096C YNL096C YNL096C YNL096C 4932.YNL096C YNL096C YNL096C SCRT_03232 YNL096C YNL096C tr|A6ZRY5|A6ZRY5_YEAS7 YNL096C YNL096C YNL096C YNL096C YNL096C YNL096C YNL096C

Jump to [ Top of page · Domain architecture · Domain assignment details ]