SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL097C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL097C-B   Protein: S000028699
Sequence length 40
Comment YNL097C-B SGDID:S000028699, Chr XIV from 440921-440799, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MTAKTKQSWNKGIWENGKQGSHQQTFLPKIWVNIYSTPTS
Download sequence
Identical sequences A6ZRY3 B3LNV6 C7GR81 C8ZGD2 G2WM07 P0C271 W7PE05 W7QWK5
YNL097C-B tr|A6ZRY3|A6ZRY3_YEAS7 YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B 4932.YNL097C-B SCRT_03234 YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]