SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL097C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNL097C-B   Protein: S000028699
Sequence length 40
Comment YNL097C-B SGDID:S000028699, Chr XIV from 440921-440799, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MTAKTKQSWNKGIWENGKQGSHQQTFLPKIWVNIYSTPTS
Download sequence
Identical sequences A6ZRY3 B3LNV6 C7GR81 C8ZGD2 G2WM07 P0C271
YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B 4932.YNL097C-B YNL097C-B SCRT_03234 YNL097C-B YNL097C-B YNL097C-B tr|A6ZRY3|A6ZRY3_YEAS7 YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B YNL097C-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]