SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL148C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL148C
Domain Number 1 Region: 106-231
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.83e-22
Family Cap-Gly domain 0.00096
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-08
Family Ubiquitin-related 0.02
Further Details:      
 

Protein sequence

External link(s) Locus: YNL148C   Protein: S000005092
Sequence length 254
Comment ALF1 SGDID:S000005092, Chr XIV from 350673-349909, reverse complement, Verified ORF, "Alpha-tubulin folding protein, similar to mammalian cofactor B; Alf1p-GFP localizes to cytoplasmic microtubules; required for the folding of alpha-tubulin and may play an additional role in microtubule maintenance"
Sequence
MVRVVIESELVRTEKELPNSLKLRQFKDRLYHVTGVEPEDMEIVVKRQYDNKEIYSTKKG
GAYSNEDEDANFLKGEEELIVVVTDSNAQSISNQLATQAEGIPSMEVISEEDYLRRDQSV
LRWKMAHGYGRFNAAQQSQRAALAKQDEAYAREQLTAAIGRHCRVTVDGSAPREAILRYV
GPLPLDVMGTWCGVEFPEAAGKNDGRINGVTLFGPVAPGHGSFVRPRAVEILSKDEESAE
VEDVHDDVESDDEI
Download sequence
Identical sequences B3LP04 C7GXU9 E7Q8D8 E7QJW0 N1P498 P53904 W7PDV2 W7QWG6
YNL148C YNL148C 4932.YNL148C YNL148C YNL148C SCRT_03283 YNL148C YNL148C YNL148C YNL148C YNL148C YNL148C YNL148c YNL148C YNL148C

Jump to [ Top of page · Domain architecture · Domain assignment details ]