SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL148C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL148C
Domain Number 1 Region: 106-231
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.83e-22
Family Cap-Gly domain 0.00096
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-08
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule 1.95 43.54
adherens junction 1.365 21.78
synapse part 1.512 20.55
axon 1.502 20.55
neuron projection terminus 2.106 20.55
endoplasmic reticulum part 1.429 17.47
cell leading edge 1.447 15.73
cytosol 1.305 13.02
cell cortex 1.621 9.94
centrosome 1.805 8.78

Protein sequence

External link(s) Locus: YNL148C   Protein: S000005092
Sequence length 254
Comment ALF1 SGDID:S000005092, Chr XIV from 350673-349909, reverse complement, Verified ORF, "Alpha-tubulin folding protein, similar to mammalian cofactor B; Alf1p-GFP localizes to cytoplasmic microtubules; required for the folding of alpha-tubulin and may play an additional role in microtubule maintenance"
Sequence
MVRVVIESELVRTEKELPNSLKLRQFKDRLYHVTGVEPEDMEIVVKRQYDNKEIYSTKKG
GAYSNEDEDANFLKGEEELIVVVTDSNAQSISNQLATQAEGIPSMEVISEEDYLRRDQSV
LRWKMAHGYGRFNAAQQSQRAALAKQDEAYAREQLTAAIGRHCRVTVDGSAPREAILRYV
GPLPLDVMGTWCGVEFPEAAGKNDGRINGVTLFGPVAPGHGSFVRPRAVEILSKDEESAE
VEDVHDDVESDDEI
Download sequence
Identical sequences B3LP04 C7GXU9 E7Q8D8 E7QJW0 N1P498 P53904 W7PDV2 W7QWG6
YNL148C YNL148C 4932.YNL148C YNL148C YNL148C SCRT_03283 YNL148C YNL148C YNL148C YNL148C YNL148C YNL148C YNL148c YNL148C YNL148C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]