SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL153C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL153C
Domain Number 1 Region: 19-120
Classification Level Classification E-value
Superfamily Prefoldin 1.88e-16
Family Prefoldin 0.0058
Further Details:      
 

Protein sequence

External link(s) Locus: YNL153C   Protein: S000005097
Sequence length 129
Comment GIM3 SGDID:S000005097, Chr XIV from 346060-345671, reverse complement, Verified ORF, "Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it"
Sequence
MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELID
EDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYAK
FGDNINLER
Download sequence
Identical sequences B3LP08 C7GXV3 E7KH19 E7QJV6 N1NXT5 P53900 W7PL93
YNL153C YNL153C YNL153C YNL153C YNL153C YNL153C YNL153C YNL153C YNL153C APC5966 YNL153C YNL153C 4932.YNL153C YNL153C YNL153C SCRT_03287 YNL153C YNL153c___KOG1760 YNL153C YNL153C

Jump to [ Top of page · Domain architecture · Domain assignment details ]