SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL172W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNL172W   Protein: S000005116
Sequence length 1748
Comment APC1 SGDID:S000005116, Chr XIV from 310638-315884, Verified ORF, "Largest subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition"
Sequence
MTSKPSTRNDYLPRETHNGEYTGDSPEWQLQINITNKIGGINGDIWLSRDGRSVKWCIED
QCLRQFTYNQKIIKAGYIDFEKTPDCFVVVLSDIAHVYMLKNGGSTTVCFPFQIGNAFWY
ANGVILERETSASFMDGGYDLKPIEFDLKHKYITLTDPMAPFGLISITNTFKGGINSASG
NKTDILQDFQLVLFPSDKDKCIAVFLDRNSKVLRFYYSRILSSDQSRKGELTISSTKKTG
LDAAGNSQKSGGISKDLRKFSHLTRRSTSINSNSHDFNAAERVLSGNVGNASGRTDIFAL
PSSCSRRSLSATLDRMGNNIAPTNRAAPSGFFDSSSANTATHSNITPVSQPMQQQQQEYL
NQTATSSKDIVLTEISSLKLPDDIIFTSRRLSSILSKLKFLSLRFERREGLLIFHEPTHF
CKIWLIDLLPDVLDSIPFKIYGNSPQNMIRLENLKLKEPSRIQAMYIHELLESCLILVSE
GQNKEEYKACLYDPFVKITSPSKNISEELTKQNSLPSLQKLFPYPETSFTKLCFEAVKYI
TSPAFNISFIFLWQSAYSILLSRANDDVVGGLKMEHDAFSLVLSLLILPIPSSSAQEYQE
YKEIYERDLFQHLKQDSEITSSVLPRIVIGLHLIREEYSLNVLCRNEHALLGQFLRFATA
AMGWPDLWQSYYVPKMDSESKTFLHPREQNSTFFHPLDEPPSITKSLYSITENSSIPLCP
FISFSRLVATDTQVELRITPRSFKILGLYELVHSPNFLPDYVLGILSSFKVDKDELQTYP
LGILVPLQNILKILEDKLSEVRDNLELLDRADLQRCSAIINSIRSDSKEVLKRGQRDSYM
LCKVPLAKNRSSLSKKPSDIYSILSEIVKSASQVPLDGSAMRMSNIQDDEDIDEGRSLKL
NAGLIFSEDKRFTHVVSLLAYYRPTKTQFFTTKTEYAQILAQKKYFAKIMALRTCTNGVG
WGAVAYATEKPISTQKWVIQPLNLISVFPDDTKITVKAPEDIAHDIVEWGQFHAGVSSGL
RISKKATGITGSWIAFNKPKELDAYHGGFLLGLGLNGHLKNLEEWHIYNYLSPRNTHISI
GLLLGMSSSMKGSMDSKLIKVISVHLVAFLPSGSSDLNIDLKLQTAGIIGMGMLYLNSRH
KRMSDSIFAQLVSLLNVNDEMVADEEYRLAAGISLGLINLGAGQTKLRKWDSSLLGLGDD
LPEDVYDSSDVEQNVMYEDLTTKLLEIVTSTYDVENDWIPENSQIGAVIAIMFLFLKSNN
FGISNMLKVDLKEILKANINTRPELLMYREWASNMILWEFIGDDLSFIMKDVDIGVKFSE
LNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILLSLVDKFLPLYQYPGKQNLDFRLTI
SVINVLTNVIVVSLSMVMCASGDLEVLRRVKYLHEVASGPYSDLFQEIPSSKSDVSGVTQ
VTSNTNTPGNSDRERVDETAASLDDERSSNGSDISDPTAYLEDKKDIDDHYGKFISTNLA
LGFLFLGSGQYALNTSTLESIAFLSMSVLPTYTTPHPLQELKHFWSIAVEPRCLVIKDIS
TGDAVNNVPIELVVEEDVEKEEVIREISTPCLLPDFSKIKSIRVKMHGYFPLEVNFTKDY
SASDFFSGGTIIYIQRKSESVFENKASFRNVEDIHVALKRKAAESKNYSRLNLKNEQGNT
TSSQLVESLGIQDLTMVELDTLLSAGNNTALTDSESYNLGLLCSDKNSGDILDCQLELWY
KSFGPHDE
Download sequence
Identical sequences YNL172W 4932.YNL172W

Jump to [ Top of page · Domain architecture · Domain assignment details ]