SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL174W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL174W   Protein: S000005118
Sequence length 190
Comment YNL174W SGDID:S000005118, Chr XIV from 308076-308648, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene NOP13/YNL175C"
Sequence
MALEFLAATRGMDNLVMSCSVTLLFSSSLSFVLAIKNLTKSSFVVSKDKLPIQTPYLFSS
FFFFFTTSPDSSPVGVLIVDSSPWASFSEAPDFFFSASSLYSSIDLGSILYFAFNSSRVT
LPLLKRRFCFFDRGMELFRSISISSSAFLFFVGSSKAFLTCSSLSFFVTASSFDSSVSDI
LSQIIESCWV
Download sequence
Identical sequences B5VQN3 C8ZG54 P53884
YNL174W 4932.YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]