SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL174W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNL174W   Protein: S000005118
Sequence length 190
Comment YNL174W SGDID:S000005118, Chr XIV from 308076-308648, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene NOP13/YNL175C"
Sequence
MALEFLAATRGMDNLVMSCSVTLLFSSSLSFVLAIKNLTKSSFVVSKDKLPIQTPYLFSS
FFFFFTTSPDSSPVGVLIVDSSPWASFSEAPDFFFSASSLYSSIDLGSILYFAFNSSRVT
LPLLKRRFCFFDRGMELFRSISISSSAFLFFVGSSKAFLTCSSLSFFVTASSFDSSVSDI
LSQIIESCWV
Download sequence
Identical sequences B5VQN3 C8ZG54 P53884
YNL174W YNL174W 4932.YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W YNL174W

Jump to [ Top of page · Domain architecture · Domain assignment details ]