SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL231C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL231C
Domain Number 1 Region: 134-319
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.98e-45
Family CRAL/TRIO domain 0.00073
Further Details:      
 
Domain Number 2 Region: 19-126
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 3.92e-16
Family CRAL/TRIO N-terminal domain 0.01
Further Details:      
 

Protein sequence

External link(s) Locus: YNL231C   Protein: S000005175
Sequence length 351
Comment PDR16 SGDID:S000005175, Chr XIV from 217043-215988, reverse complement, Verified ORF, "Phosphatidylinositol transfer protein (PITP) controlled by the multiple drug resistance regulator Pdr1p, localizes to lipid particles and microsomes, controls levels of various lipids, may regulate lipid synthesis, homologous to Pdr17p"
Sequence
MFKRFSKKKEAPEDPKNLINIDKPIKELPASIAIPKEKPLTGEQQKMYDEVLKHFSNPDL
KVYTSEKNKSEDDLKPLEEEEKAWLTRECFLRYLRATKWVLKDCIDRITMTLAWRREFGI
SHLGEEHGDKITADLVAVENESGKQVILGYENDARPILYLKPGRQNTKTSHRQVQHLVFM
LERVIDFMPAGQDSLALLIDFKDYPDVPKVPGNSKIPPIGVGKEVLHILQTHYPERLGKA
LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFVKYVPKNELDSLYGGDLKFKYNHDVY
WPALVETAREKRDHYFKRFQSFGGIVGLSEVDLRGTHEKLLYPVKSESSTV
Download sequence
Identical sequences B3LP72 B5VQH9 C7GPC8 E7KHF1 E7LZ83 H0GMA6 P53860 W7PDP8
YNL231C YNL231C YNL231C YNL231C YNL231C YNL231C YNL231C YNL231C YNL231C 4932.YNL231C YNL231C YNL231C SCRT_03356 YNL231C YNL231C YNL231C

Jump to [ Top of page · Domain architecture · Domain assignment details ]