SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL242W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNL242W   Protein: S000005186
Sequence length 1592
Comment ATG2 SGDID:S000005186, Chr XIV from 191325-196103, Verified ORF, "Peripheral membrane protein required for vesicle formation during autophagy, pexophagy, and the cytoplasm-to-vaucole targeting (Cvt) pathway; involved in Atg9p cycling between the pre-autophagosomal structure and mitochondria"
Sequence
MAFWLPQNIQKRLLLYVLQQISLFSNIDLSNLDVSIGSKSHFSFHDVNLSLDDLNIPNVQ
INEGIVDELVLKLTVSGGVEIDGSGLRFIMTPLYSSGSQELHSDFLVKSIQDLTNSMLQF
SDPLTTYNRYKEDDISSSDSSSDLNSNIEASKPAANGSYTLQNMRNKALNVALAKLKIAL
KDVTIRFIVNDRDPSDNIVEVHLESIQLITTDANLRHINIENITISSIQKQAVPDSPVHP
FNNDDLSQSVYLSKMEATSLYMSAMEEQSNEDPSEPQVTQEEQENDKCKESLMEINNLNI
AFKGLSSVNDLRMSNIVIDIQDVHLAIHKIVEIKNSTLKNIIDIIVTHLDANESFSCQDS
QSPSPDKQEPSALSSVDIKCIYLNLGQDITVILKSFKLEQKENNSLAFSLGSFYSNSSPL
TISHKTKPLLTGEQTPQSIALNMGDELDIIISHDGIAHFFKIFQFVSKCMSFYQNKSKGM
MPQIASDTKRTVQLTSKAVKLSLKFPYFLLCFQVSPFIYDSNRELYIELVDVFKKLPSRC
TKILTMSSITISNLQSPLQLGSYDDTLKEALIYSSVHAIIKEVIFNEEYSGIVQLVEDIS
AFGKLFTDSKNSECTGKSKSKRGSFLQRSVRVLNSSRFVYKQSLSANFSLKIDSMKLKVS
EIIGPQFGSVEALLSNNFFAITDDSQIVYFTKNLKVERKTPSLLEPQEIMSVVLNKAVNE
PVLYVHRRANGKLKVIFNNIRIHYYARWLEILKKNIGPDNASSKDEPVSQKLSKKQPTSG
FPWELKCLDCSLILHPFRLKSVMVIVLDNLTTGGSSFIPQAKLLSKANTLFLIDDYQNFK
IQKDKNWPSLINFYAGQGFSAIGKIDTLNFLINKSDGALLLDCKIEQVGLSLCADSFQTF
CQLCIDLKYPQTFPDEEKFRTQLKNPIDVFKDIDCDLFNSAFIRENNHQNDYDSVHLVDS
FLDKTHEFNNGARSKLSSQGSYEMDSSSGTATGGILLPHESYLDSAQPKEEDTPPIASKE
QERDVDIRGSIDVEKVVIKLFDGYDWKYTRKFIANTVEKLDKELSKAEASSSKSNVPQSE
ANIFDSIYISANKNNVTDLRRNLDGEIQGVQNSFSDVSKVNLRPSKHYKALIQLNKVHVN
LKNYRVDEPDESNSDNSTDVLNRCVVSIYEFEIIDNVPTSTWNKFVTLLKHEPWPHSSPM
FLLDLEFIRPIDFLQAVELVMQLNVAPLRLHVDQDTLEFLIRFLGFKDKRFELIDEYPDI
VFIQKFSTNSIKLRLDYKPKKVDYAGLRSGQTSELMNFFTLDGSKIILKSVVLYGLNGFD
ELNNKLKAIWTPDITKKQLPGVLEGLAPVRSFMAIGSGVKTLVTVLMSEYRQEGHLGRSL
KKGGNVFLKTTTGDFVKLGVKLTSGTQAILENTEELFGGVGSNGRVYDASKFGSADGADS
DTAAVLDLDTLFEEDQLVGSKYSRIRDHEPTAVVIDMSSPGDHNEPTIVSLYADQPLDLP
TGLKEAYSSLEKHMHIAYDAVWRAKGQMKDDKRGGPSAAAVYVARAAPVAIIRPLIGATE
AVSKTLQGIANQVDKTHNEQINDKYKSNRTDS
Download sequence
Identical sequences P53855
YNL242W 4932.YNL242W YNL242W YNL242W YNL242W

Jump to [ Top of page · Domain architecture · Domain assignment details ]