SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL242W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL242W   Protein: S000005186
Sequence length 1592
Comment ATG2 SGDID:S000005186, Chr XIV from 191325-196103, Verified ORF, "Peripheral membrane protein required for vesicle formation during autophagy, pexophagy, and the cytoplasm-to-vaucole targeting (Cvt) pathway; involved in Atg9p cycling between the pre-autophagosomal structure and mitochondria"
Sequence
MAFWLPQNIQKRLLLYVLQQISLFSNIDLSNLDVSIGSKSHFSFHDVNLSLDDLNIPNVQ
INEGIVDELVLKLTVSGGVEIDGSGLRFIMTPLYSSGSQELHSDFLVKSIQDLTNSMLQF
SDPLTTYNRYKEDDISSSDSSSDLNSNIEASKPAANGSYTLQNMRNKALNVALAKLKIAL
KDVTIRFIVNDRDPSDNIVEVHLESIQLITTDANLRHINIENITISSIQKQAVPDSPVHP
FNNDDLSQSVYLSKMEATSLYMSAMEEQSNEDPSEPQVTQEEQENDKCKESLMEINNLNI
AFKGLSSVNDLRMSNIVIDIQDVHLAIHKIVEIKNSTLKNIIDIIVTHLDANESFSCQDS
QSPSPDKQEPSALSSVDIKCIYLNLGQDITVILKSFKLEQKENNSLAFSLGSFYSNSSPL
TISHKTKPLLTGEQTPQSIALNMGDELDIIISHDGIAHFFKIFQFVSKCMSFYQNKSKGM
MPQIASDTKRTVQLTSKAVKLSLKFPYFLLCFQVSPFIYDSNRELYIELVDVFKKLPSRC
TKILTMSSITISNLQSPLQLGSYDDTLKEALIYSSVHAIIKEVIFNEEYSGIVQLVEDIS
AFGKLFTDSKNSECTGKSKSKRGSFLQRSVRVLNSSRFVYKQSLSANFSLKIDSMKLKVS
EIIGPQFGSVEALLSNNFFAITDDSQIVYFTKNLKVERKTPSLLEPQEIMSVVLNKAVNE
PVLYVHRRANGKLKVIFNNIRIHYYARWLEILKKNIGPDNASSKDEPVSQKLSKKQPTSG
FPWELKCLDCSLILHPFRLKSVMVIVLDNLTTGGSSFIPQAKLLSKANTLFLIDDYQNFK
IQKDKNWPSLINFYAGQGFSAIGKIDTLNFLINKSDGALLLDCKIEQVGLSLCADSFQTF
CQLCIDLKYPQTFPDEEKFRTQLKNPIDVFKDIDCDLFNSAFIRENNHQNDYDSVHLVDS
FLDKTHEFNNGARSKLSSQGSYEMDSSSGTATGGILLPHESYLDSAQPKEEDTPPIASKE
QERDVDIRGSIDVEKVVIKLFDGYDWKYTRKFIANTVEKLDKELSKAEASSSKSNVPQSE
ANIFDSIYISANKNNVTDLRRNLDGEIQGVQNSFSDVSKVNLRPSKHYKALIQLNKVHVN
LKNYRVDEPDESNSDNSTDVLNRCVVSIYEFEIIDNVPTSTWNKFVTLLKHEPWPHSSPM
FLLDLEFIRPIDFLQAVELVMQLNVAPLRLHVDQDTLEFLIRFLGFKDKRFELIDEYPDI
VFIQKFSTNSIKLRLDYKPKKVDYAGLRSGQTSELMNFFTLDGSKIILKSVVLYGLNGFD
ELNNKLKAIWTPDITKKQLPGVLEGLAPVRSFMAIGSGVKTLVTVLMSEYRQEGHLGRSL
KKGGNVFLKTTTGDFVKLGVKLTSGTQAILENTEELFGGVGSNGRVYDASKFGSADGADS
DTAAVLDLDTLFEEDQLVGSKYSRIRDHEPTAVVIDMSSPGDHNEPTIVSLYADQPLDLP
TGLKEAYSSLEKHMHIAYDAVWRAKGQMKDDKRGGPSAAAVYVARAAPVAIIRPLIGATE
AVSKTLQGIANQVDKTHNEQINDKYKSNRTDS
Download sequence
Identical sequences P53855
4932.YNL242W YNL242W YNL242W YNL242W YNL242W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]