SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL247W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL247W
Domain Number 1 Region: 36-114,228-473
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.58e-80
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000127
Further Details:      
 
Domain Number 2 Region: 509-657
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000000654
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0082
Further Details:      
 

Protein sequence

External link(s) Locus: YNL247W   Protein: S000005191
Sequence length 767
Comment YNL247W SGDID:S000005191, Chr XIV from 182876-185179, Verified ORF, "Essential protein of unknown function; may interact with ribosomes, based on co-purification experiments"
Sequence
MNIFIKALRRYTIMSTPKIVQPKWKVPTPQAKETVLKLYNSLTRSKVEFIPQSGNRGVTW
YSCGPTVYDASHMGHARNYVSIDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLF
DNFVKENDTKFNATVVDKVKTALFQYINKNFTIQGSEIKTIEEFETWLSNADTETLKLEN
PKFPMHVTAVQNAIESITKGDSMDAEVAFEKVKDVTVPLLDKELGSTISNPEIFRQLPAY
WEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDK
SPNHDYAKCQPWNKGQLDLINDGEGSLSNFADNGKKSNNDFALWKASKAGEPEWESPWGK
GRPGWHIECSVMASDILGSNIDIHSGGIDLAFPHHDNELAQSEARFDNQQWINYFLHTGH
LHIEGQKMSKSLKNFITIQEALKKFSPRQLRLAFASVQWNNQLDFKESLIHEVKSFENSM
NNFFKTIRALKNDAASAGHISKKFSPLEKELLADFVESESKVHSAFCDNLSTPVALKTLS
ELVTKSNTYITTAGAALKIEPLIAICSYITKILRIIGFPSRPDNLGWAAQAGSNDGSLGS
LEDTVMPYVKCLSTFRDDVRSLAIKKAEPKEFLQLTDKIRNEDLLNLNVALDDRNGQSAL
IKFLTNDEKLEIVKLNEEKHANELAKKQKKLEQQKLREQKENERKQKAQIKPQDMFKDVT
LYSAWDEQGLPTKDKDGNDITKSMTKKLKKQWEQQKKLHEEYFGEDK
Download sequence
Identical sequences P53852
YNL247W 4932.YNL247W YNL247W YNL247W YNL247W YNL247W YNL247W

Jump to [ Top of page · Domain architecture · Domain assignment details ]