SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YNL247W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL247W
Domain Number 1 Region: 36-114,228-473
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.58e-80
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000127
Further Details:      
 
Domain Number 2 Region: 509-657
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000000654
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.334 5.45
microtubule associated complex 1.999 5.45
mitochondrial matrix 1.707 4.89
plastid 1.598 4.85
chloroplast part 1.897 4.85
plastid stroma 2.025 4.77

Protein sequence

External link(s) Locus: YNL247W   Protein: S000005191
Sequence length 767
Comment YNL247W SGDID:S000005191, Chr XIV from 182876-185179, Verified ORF, "Essential protein of unknown function; may interact with ribosomes, based on co-purification experiments"
Sequence
MNIFIKALRRYTIMSTPKIVQPKWKVPTPQAKETVLKLYNSLTRSKVEFIPQSGNRGVTW
YSCGPTVYDASHMGHARNYVSIDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLF
DNFVKENDTKFNATVVDKVKTALFQYINKNFTIQGSEIKTIEEFETWLSNADTETLKLEN
PKFPMHVTAVQNAIESITKGDSMDAEVAFEKVKDVTVPLLDKELGSTISNPEIFRQLPAY
WEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDK
SPNHDYAKCQPWNKGQLDLINDGEGSLSNFADNGKKSNNDFALWKASKAGEPEWESPWGK
GRPGWHIECSVMASDILGSNIDIHSGGIDLAFPHHDNELAQSEARFDNQQWINYFLHTGH
LHIEGQKMSKSLKNFITIQEALKKFSPRQLRLAFASVQWNNQLDFKESLIHEVKSFENSM
NNFFKTIRALKNDAASAGHISKKFSPLEKELLADFVESESKVHSAFCDNLSTPVALKTLS
ELVTKSNTYITTAGAALKIEPLIAICSYITKILRIIGFPSRPDNLGWAAQAGSNDGSLGS
LEDTVMPYVKCLSTFRDDVRSLAIKKAEPKEFLQLTDKIRNEDLLNLNVALDDRNGQSAL
IKFLTNDEKLEIVKLNEEKHANELAKKQKKLEQQKLREQKENERKQKAQIKPQDMFKDVT
LYSAWDEQGLPTKDKDGNDITKSMTKKLKKQWEQQKKLHEEYFGEDK
Download sequence
Identical sequences P53852
YNL247W YNL247W YNL247W YNL247W YNL247W YNL247W 4932.YNL247W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]