SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL284C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YNL284C-A
Domain Number - Region: 68-173
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0602
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL284C-A   Protein: S000007386
Sequence length 440
Comment YNL284C-A SGDID:S000007386, Chr XIV from 102232-100910, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENPHHASPQTAQSHSPQNGPYQQQCMMTQNQANPSGWSFYGRPSMIPYTPYQMSPM
YFPPGPHSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FLNWVKTYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFAPSQFLPTWVKDI
LSADYTDIMKILSKSINKMQSDTQEVNDITTLATLHYNGSTPADAFEAEVTNILDRLNNN
GIPINNKVACQFIMRGLSGEYKFLRYARHRYIHMTVADLFSDIHSMYEEQQESKRNKSTY
RRNPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTSNNSSGPDNDLIRGS
TTEPIQLKNKHDLHLRPGTY
Download sequence
Identical sequences A7A2A5 Q12391
YNL284C-A YNL284C-A 4932.YNL284C-A YNL284C-A YNL284C-A YNL284C-A tr|A7A2A5|A7A2A5_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]