SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL284C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YNL284C-A
Domain Number - Region: 68-173
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0602
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Protein sequence

External link(s) Locus: YNL284C-A   Protein: S000007386
Sequence length 440
Comment YNL284C-A SGDID:S000007386, Chr XIV from 102232-100910, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENPHHASPQTAQSHSPQNGPYQQQCMMTQNQANPSGWSFYGRPSMIPYTPYQMSPM
YFPPGPHSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FLNWVKTYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFAPSQFLPTWVKDI
LSADYTDIMKILSKSINKMQSDTQEVNDITTLATLHYNGSTPADAFEAEVTNILDRLNNN
GIPINNKVACQFIMRGLSGEYKFLRYARHRYIHMTVADLFSDIHSMYEEQQESKRNKSTY
RRNPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTSNNSSGPDNDLIRGS
TTEPIQLKNKHDLHLRPGTY
Download sequence
Identical sequences A7A2A5 Q12391
YNL284C-A YNL284C-A 4932.YNL284C-A YNL284C-A YNL284C-A YNL284C-A tr|A7A2A5|A7A2A5_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]