SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL293W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL293W
Domain Number 1 Region: 207-384
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 2 Region: 426-477
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.65e-13
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 

Protein sequence

External link(s) Locus: YNL293W   Protein: S000005237
Sequence length 633
Comment MSB3 SGDID:S000005237, Chr XIV from 80640-82541, Verified ORF, "GTPase-activating protein for Sec4p and several other Rab GTPases, regulates exocytosis via its action on Sec4p, also required for proper actin organization; similar to Msb4p; both Msb3p and Msb4p localize to sites of polarized growth"
Sequence
MQNDQQRFSLQNRTVLAHPYKRLGGAFTVKSPSVPNFHDKMHSDHSSSDSALVNGSFRAN
DHRSVEPSCLGQASPSEHDGNLSVIDLYGDEVESQRAEGEDDDDNNGDNGNEDLEEVHSD
DLDLVPDDDNRQRVELEGAASATSANSNGINNTHFDRYGFKKQNNYISEAEYDKWWVEYS
QYCVRRKHKWQLLLEKSGLPVTDDSPSRFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQ
EKLNKNKGVYSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEGP
PIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVIITSRYLPGVHNI
NLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYR
LPPITLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDLSKIKP
RNNSLNYSWGSNLNQRGGSMGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLNR
LDQDEIDRCRKFVAAQRLKFKTYGELLGNSTSEADLPINDNTDNKGIHITSDAVNEALSS
EVYGFKKSLAGVHWNNSIKEKVKQMRKKKDKGD
Download sequence
Identical sequences A6ZSI5 B3LPD1 B5VQC4 C7GS56 P48566 W7PAM0 W7R5Z5
YNL293W YNL293W 4932.YNL293W YNL293W YNL293W SCRT_03420 YNL293W YNL293W tr|A6ZSI5|A6ZSI5_YEAS7 YNL293W YNL293W YNL293W YNL293W

Jump to [ Top of page · Domain architecture · Domain assignment details ]