SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL293W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL293W
Domain Number 1 Region: 207-384
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 2 Region: 426-477
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.65e-13
Family Ypt/Rab-GAP domain of gyp1p 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
GTPase activator activity 1.95 56.86
Rab GTPase binding 2.13 42.55
enzyme activator activity 1.401 38.59
nucleoside-triphosphatase regulator activity 1.535 36.07
protein complex binding 1.491 11.83
integrin binding 1.753 11.83
GTPase binding 1.682 8.71
Cellular Component IC (bits) H-Score
neuromuscular junction 2.011 16.92
synapse part 1.512 5.1
axon 1.502 5.1
neuron projection terminus 2.106 5.1
endosome 1.322 4.44

Protein sequence

External link(s) Locus: YNL293W   Protein: S000005237
Sequence length 633
Comment MSB3 SGDID:S000005237, Chr XIV from 80640-82541, Verified ORF, "GTPase-activating protein for Sec4p and several other Rab GTPases, regulates exocytosis via its action on Sec4p, also required for proper actin organization; similar to Msb4p; both Msb3p and Msb4p localize to sites of polarized growth"
Sequence
MQNDQQRFSLQNRTVLAHPYKRLGGAFTVKSPSVPNFHDKMHSDHSSSDSALVNGSFRAN
DHRSVEPSCLGQASPSEHDGNLSVIDLYGDEVESQRAEGEDDDDNNGDNGNEDLEEVHSD
DLDLVPDDDNRQRVELEGAASATSANSNGINNTHFDRYGFKKQNNYISEAEYDKWWVEYS
QYCVRRKHKWQLLLEKSGLPVTDDSPSRFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQ
EKLNKNKGVYSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEGP
PIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVIITSRYLPGVHNI
NLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYR
LPPITLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDLSKIKP
RNNSLNYSWGSNLNQRGGSMGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLNR
LDQDEIDRCRKFVAAQRLKFKTYGELLGNSTSEADLPINDNTDNKGIHITSDAVNEALSS
EVYGFKKSLAGVHWNNSIKEKVKQMRKKKDKGD
Download sequence
Identical sequences A6ZSI5 B3LPD1 B5VQC4 C7GS56 P48566 W7PAM0 W7R5Z5
YNL293W YNL293W 4932.YNL293W YNL293W YNL293W SCRT_03420 YNL293W YNL293W tr|A6ZSI5|A6ZSI5_YEAS7 YNL293W YNL293W YNL293W YNL293W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]