SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL304W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL304W
Domain Number 1 Region: 90-112,196-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-32
Family G proteins 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74
protein-DNA complex 1.923 15.74

Protein sequence

External link(s) Locus: YNL304W   Protein: S000005248
Sequence length 417
Comment YPT11 SGDID:S000005248, Chr XIV from 60297-61550, Verified ORF, "Rab-type small GTPase that interacts with the C-terminal tail domain of Myo2p to mediate distribution of mitochondria to daughter cells"
Sequence
MSQRKRYSLNVVTSPSIPSPTPSAPIRTNESNWEAASPASAASSFLPNVHHGGTVLNPGL
GIMRSPSLNKSGAFGRSGSSGSSTVIEPSNIKLLLIGDANVGKTAMILSYCRELLTRAEM
SRSARLRHQQQQQHKDLGLKKTVVNHRLSMKEKRKRYSSNDFEKEFKDINHFADETSDFG
NPNIGDDNNHEMADPNEIVIETRSTIGIDIKTNLVNIDNRFFNVILWDTAGQERYQNAII
PSLYKKTNAVILTYDITNAKSFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKER
QVTHYDVVQMVQEMQLKHGIKISGNFEVSCKWVNVVERTMNMIILDLVENGCFENNDPCV
SITTSDDVQGHEQEFHDTVEEPFNFTRQRQHQLEKNNTVDITKPNDDIANNQSICCV
Download sequence
Identical sequences A0A0L8VI35 B5VQB6 C7GWQ1 E7KH86 E7LZ53 N1P4J4 P48559
YNL304W YNL304W YNL304W YNL304W YNL304W 4932.YNL304W YNL304W YNL304W YNL304W YNL304W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]