SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL304W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL304W
Domain Number 1 Region: 90-112,196-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-32
Family G proteins 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.332 27.17
transporter complex 1.655 21.75
cilium 1.616 21.53
chromosomal part 1.456 20.39
ciliary part 1.785 20.28
midbody 2.192 17.88
side of membrane 1.587 15.98
protein-DNA complex 1.891 15.71
endosome 1.317 12.57
plasma membrane protein complex 1.484 10.85

Protein sequence

External link(s) Locus: YNL304W   Protein: S000005248
Sequence length 417
Comment YPT11 SGDID:S000005248, Chr XIV from 60297-61550, Verified ORF, "Rab-type small GTPase that interacts with the C-terminal tail domain of Myo2p to mediate distribution of mitochondria to daughter cells"
Sequence
MSQRKRYSLNVVTSPSIPSPTPSAPIRTNESNWEAASPASAASSFLPNVHHGGTVLNPGL
GIMRSPSLNKSGAFGRSGSSGSSTVIEPSNIKLLLIGDANVGKTAMILSYCRELLTRAEM
SRSARLRHQQQQQHKDLGLKKTVVNHRLSMKEKRKRYSSNDFEKEFKDINHFADETSDFG
NPNIGDDNNHEMADPNEIVIETRSTIGIDIKTNLVNIDNRFFNVILWDTAGQERYQNAII
PSLYKKTNAVILTYDITNAKSFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKER
QVTHYDVVQMVQEMQLKHGIKISGNFEVSCKWVNVVERTMNMIILDLVENGCFENNDPCV
SITTSDDVQGHEQEFHDTVEEPFNFTRQRQHQLEKNNTVDITKPNDDIANNQSICCV
Download sequence
Identical sequences B5VQB6 C7GWQ1 E7KH86 E7LZ53 N1P4J4 P48559 W7PDN0 W7QTN0
YNL304W YNL304W YNL304W YNL304W YNL304W YNL304W YNL304W 4932.YNL304W YNL304W YNL304W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]