SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL304W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL304W
Domain Number 1 Region: 90-112,196-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-32
Family G proteins 0.00073
Further Details:      
 

Protein sequence

External link(s) Locus: YNL304W   Protein: S000005248
Sequence length 417
Comment YPT11 SGDID:S000005248, Chr XIV from 60297-61550, Verified ORF, "Rab-type small GTPase that interacts with the C-terminal tail domain of Myo2p to mediate distribution of mitochondria to daughter cells"
Sequence
MSQRKRYSLNVVTSPSIPSPTPSAPIRTNESNWEAASPASAASSFLPNVHHGGTVLNPGL
GIMRSPSLNKSGAFGRSGSSGSSTVIEPSNIKLLLIGDANVGKTAMILSYCRELLTRAEM
SRSARLRHQQQQQHKDLGLKKTVVNHRLSMKEKRKRYSSNDFEKEFKDINHFADETSDFG
NPNIGDDNNHEMADPNEIVIETRSTIGIDIKTNLVNIDNRFFNVILWDTAGQERYQNAII
PSLYKKTNAVILTYDITNAKSFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKER
QVTHYDVVQMVQEMQLKHGIKISGNFEVSCKWVNVVERTMNMIILDLVENGCFENNDPCV
SITTSDDVQGHEQEFHDTVEEPFNFTRQRQHQLEKNNTVDITKPNDDIANNQSICCV
Download sequence
Identical sequences B5VQB6 C7GWQ1 E7KH86 E7LZ53 N1P4J4 P48559 W7PDN0 W7QTN0
YNL304W YNL304W 4932.YNL304W YNL304W YNL304W YNL304W YNL304W YNL304W YNL304W YNL304W

Jump to [ Top of page · Domain architecture · Domain assignment details ]