SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL315C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YNL315C
Domain Number - Region: 42-93
Classification Level Classification E-value
Superfamily AF1531-like 0.0118
Family AF1531-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL315C   Protein: S000005259
Sequence length 318
Comment ATP11 SGDID:S000005259, Chr XIV from 44279-43323, reverse complement, Verified ORF, "Molecular chaperone, required for the assembly of alpha and beta subunits into the F1 sector of mitochondrial F1F0 ATP synthase"
Sequence
MWRLTRKIGTRIHISNQLSPIFNKAIGTVPVFRFYSSSPEQKYRKKLLEEAQKQGFNSIE
ELKNHLKETIESKKREFNKIDPLKELEDYQQKTQMENNNSKHLMTKSRSPLDPSAPKVPF
KTLDSFLDVGKLKDLSKQEVEFLWRARWAQKDNTLCAVIPVSVYDKMMANARNNPIFVLP
LPRQVQSEDAKPNEEQGMELHYIQWQFVGPQTTHCMMTSLAEYKLHQEFARPHTTLQFHS
DLVKDKGIVFMNGHVEPDTNVNVQDAQLLLLNVQRFYGAMGEETPVAKQRVQLLRDFSKA
SPGFTVEKLISLSQSMEN
Download sequence
Identical sequences G2WLF4 N1NWG8 P32453
4932.YNL315C YNL315C YNL315C YNL315C YNL315C YNL315C YNL315c YNL315C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]