SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL334C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL334C
Domain Number 1 Region: 3-215
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.21e-43
Family Class I glutamine amidotransferases (GAT) 0.00032
Further Details:      
 

Protein sequence

External link(s) Locus: YNL334C   Protein: S000005278
Sequence length 222
Comment SNO2 SGDID:S000005278, Chr XIV from 12876-12208, reverse complement, Verified ORF, "Protein of unknown function, nearly identical to Sno3p; expression is induced before the diauxic shift and also in the absence of thiamin"
Sequence
MTVVIGVLALQGAFIEHVRHVEKCIVENRDFYEKKLSVMTVKDKNQLAQCDALIIPGGES
TAMSLIAERTGFYDDLYAFVHNPSKVTWGTCAGMIYISQQLSNEEKLVKTLNLLKVKVKR
NAFGRQAQSSTRICDFSNFIPHCNDFPATFIRAPVIEEVLDPEHVQVLYKLDGKDNGGQE
LIVAAKQKNNILATSFHPELAENDIRFHDWFIREFVLKNYSK
Download sequence
Identical sequences A6ZRF9 B3LPG6 B5VHX0 E7KJT0 P53823 W7PKN7
YNL334C YNL334C YFL060C YNL334C YFL060C YNL334C YNL334C YFL060C YNL334C YFL060C YNL334C YT247 YNL334C YNL334C 4932.YNL334C YNL334C YNL334C SCRT_03457 tr|A6ZRF9|A6ZRF9_YEAS7 YFL060C YNL334C

Jump to [ Top of page · Domain architecture · Domain assignment details ]