SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YNL338W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL338W   Protein: S000005282
Sequence length 52
Comment YNL338W SGDID:S000005282, Chr XIV from 6561-6719, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps TEL14L-XC, which is Telomeric X element Core sequence on the left arm of Chromosome XIV"
Sequence
MSLRPCLTPSSMQYSDIYIPTPTPTHHTHTPTPHPHPHTHTHTHHNPNPTLF
Download sequence
Identical sequences P53820
YNL338W YNL338W YNL338W 4932.YNL338W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]