SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNL338W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNL338W   Protein: S000005282
Sequence length 52
Comment YNL338W SGDID:S000005282, Chr XIV from 6561-6719, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps TEL14L-XC, which is Telomeric X element Core sequence on the left arm of Chromosome XIV"
Sequence
MSLRPCLTPSSMQYSDIYIPTPTPTHHTHTPTPHPHPHTHTHTHHNPNPTLF
Download sequence
Identical sequences P53820
YNL338W 4932.YNL338W YNL338W YNL338W

Jump to [ Top of page · Domain architecture · Domain assignment details ]