SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL339W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL339W-B   Protein: S000028704
Sequence length 160
Comment YNL339W-B SGDID:S000028704, Chr XIV from 734-1216, Dubious ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALFFVPVQKVLQH
LCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV
DLSPFYAKKFQIPYRVPMIWLDVFQVFFVFLVISQHSLHS
Download sequence
Identical sequences A6ZRE8 P0CL34 P0CL35 P0CL36
YBL113W-A YEL077W-A YHR219C-A YLL066W-A YLL067W-A YHR219C-A YML133W-B YNL339W-B tr|A6ZRE8|A6ZRE8_YEAS7 YHR219C-A YML133W-B YNL339W-B YHR219C-A YML133W-B YNL339W-B 4932.YHR219C-A 4932.YML133W-B 4932.YNL339W-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]