SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNR003W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNR003W-A   Protein: S000028705
Sequence length 32
Comment YNR003W-A SGDID:S000028705, Chr XIV from 634422-634520, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the verified gene RPC34/YNR003C"
Sequence
MENSSSSSKALLPASGSPSPWFICRMLSKVTL
Download sequence
Identical sequences C8ZFN0 Q8TGL7
YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A 4932.YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]