SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNR003W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YNR003W-A   Protein: S000028705
Sequence length 32
Comment YNR003W-A SGDID:S000028705, Chr XIV from 634422-634520, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the verified gene RPC34/YNR003C"
Sequence
MENSSSSSKALLPASGSPSPWFICRMLSKVTL
Download sequence
Identical sequences C8ZFN0 Q8TGL7
YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A 4932.YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A YNR003W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]