SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNR017W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YNR017W   Protein: S000005300
Sequence length 222
Comment TIM23 SGDID:S000005300, Chr XIV from 662915-663583, Verified ORF, "Essential protein of the mitochondrial inner membrane, component of the mitochondrial import system"
Sequence
MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP
LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG
LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG
AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK
Download sequence
Identical sequences A6ZS91 B3LPM5 C7GLN8 C8ZFP4 E7LZR2 E7QK50 H0GMT7 N1NZP8 P32897 W7PAD5 W7QVZ6
YNR017W 4932.YNR017W YNR017W YNR017W YNR017W SCRT_03126 YNR017W YNR017W tr|A6ZS91|A6ZS91_YEAS7 YNR017W YNR017W YNR017W YNR017W YNR017W YNR017W 355512 YT190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]