SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNR052C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNR052C
Domain Number 1 Region: 150-430
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.81e-82
Family CAF1-like ribonuclease 0.0000000000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
replication fork 2.208 26.38
cytoplasmic ribonucleoprotein granule 1.98 22.55
ribonucleoprotein complex 1.414 15.53
small nuclear ribonucleoprotein complex 2.005 13.11
DNA repair complex 2.141 11.46
exosome (RNase complex) 2.218 10.38
nucleoplasm part 1.496 5.59
nuclear body 1.907 5.59
chromosomal part 1.477 5.22
transferase complex 1.423 5.16

Protein sequence

External link(s) Locus: YNR052C   Protein: S000005335
Sequence length 433
Comment POP2 SGDID:S000005335, Chr XIV from 720649-719348, reverse complement, Verified ORF, "RNase of the DEDD superfamily, subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA deadenylation"
Sequence
MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQGMPVNTINGS
VNQEMNNAYLLKQKNEPLLTQQQQQQQQQQQPFNIGTPVSVASLPPGLNVLQQQQQQQQQ
QQQQQQGVGLNRPLASQLPKHLTNQSMPPIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVS
QYNHVSISTEFVGTLARPIGTFRSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNG
PSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSV
TWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNPQLQ
QSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFA
KYQGVIYGIDGDQ
Download sequence
Identical sequences B3LPJ1 C7GLK5 C8ZFT1 P39008 W7PWL4
YNR052C YNR052C YNR052C SCRT_03091 4932.YNR052C YNR052C YNR052C YNR052C YNR052C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]