SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNR052C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNR052C
Domain Number 1 Region: 150-430
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.81e-82
Family CAF1-like ribonuclease 0.0000000000557
Further Details:      
 

Protein sequence

External link(s) Locus: YNR052C   Protein: S000005335
Sequence length 433
Comment POP2 SGDID:S000005335, Chr XIV from 720649-719348, reverse complement, Verified ORF, "RNase of the DEDD superfamily, subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA deadenylation"
Sequence
MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQGMPVNTINGS
VNQEMNNAYLLKQKNEPLLTQQQQQQQQQQQPFNIGTPVSVASLPPGLNVLQQQQQQQQQ
QQQQQQGVGLNRPLASQLPKHLTNQSMPPIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVS
QYNHVSISTEFVGTLARPIGTFRSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNG
PSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSV
TWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNPQLQ
QSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFA
KYQGVIYGIDGDQ
Download sequence
Identical sequences B3LPJ1 C7GLK5 C8ZFT1 P39008 W7PWL4
YNR052C 4932.YNR052C YNR052C YNR052C SCRT_03091 YNR052C YNR052C YNR052C YNR052C

Jump to [ Top of page · Domain architecture · Domain assignment details ]