SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNR076W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YNR076W   Protein: S000005359
Sequence length 120
Comment PAU6 SGDID:S000005359, Chr XIV from 781918-782280, Verified ORF, "Part of 23-member seripauperin multigene family encoded mainly in subtelomeric regions, active during alcoholic fermentation, regulated by anaerobiosis, negatively regulated by oxygen, repressed by heme"
Sequence
MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSTRLKPAISKALSKDGIYTIAN
Download sequence
Identical sequences A7A0J6 B3LTH0 C8ZAU4 E7LU41 E7NPE0 E7QK88 H0GJG6 P0CE90 P0CE91
YLL064C YLL064C YNR076W YT725 YHL046C YLL064C YNR076W YLL064C YNR076W YLL064C YNR076W tr|A7A0J6|A7A0J6_YEAS7 4932.YLL064C 4932.YNR076W SCRT_05138 YLL064C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]