SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YNR076W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YNR076W   Protein: S000005359
Sequence length 120
Comment PAU6 SGDID:S000005359, Chr XIV from 781918-782280, Verified ORF, "Part of 23-member seripauperin multigene family encoded mainly in subtelomeric regions, active during alcoholic fermentation, regulated by anaerobiosis, negatively regulated by oxygen, repressed by heme"
Sequence
MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSTRLKPAISKALSKDGIYTIAN
Download sequence
Identical sequences A7A0J6 B3LTH0 C8ZAU4 E7LU41 E7NPE0 E7QK88 H0GJG6 P0CE90 P0CE91
YLL064C YNR076W 4932.YLL064C 4932.YNR076W YLL064C YNR076W YLL064C SCRT_05138 YLL064C tr|A7A0J6|A7A0J6_YEAS7 YT725 YLL064C YNR076W YHL046C YLL064C YNR076W

Jump to [ Top of page · Domain architecture · Domain assignment details ]