SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL005C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL005C
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.57e-36
Family RBP11/RpoL 1.85e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YOL005C   Protein: S000005365
Sequence length 120
Comment RPB11 SGDID:S000005365, Chr XV from 316176-315814, reverse complement, Verified ORF, "RNA polymerase II subunit B12.5; part of central core; similar to Rpc19p and bacterial alpha subunit"
Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
Download sequence
Identical sequences A6ZNK1 B3LJ51 C7GJV7 E7KHS4 E7M061 E7NNA8 E7Q959 E7QKJ6 G2WMM6 H0GNB1 N1P2V7 P38902 W7P9I4 W7R4M5
YOL005C 1twfK YOL005C ORFP:20286 YOL005C YOL005C YOL005C YOL005C YOL005C YOL005C YT57 YOL005C YOL005C YOL005C YOL005C 4932.YOL005C YOL005C YOL005C SCRT_01398 YOL005C YOL005C tr|A6ZNK1|A6ZNK1_YEAS7 1i3q.K 1i50.K 1i6h.K 1k83.K 1nik.K 1nt9.K 1pqv.K 1r5u.K 1r9r.K 1r9s.K 1r9t.K 1sfo.K 1twa.K 1twc.K 1twf.K 1twg.K 1twh.K 1wcm.K 1y1v.K 1y1w.K 1y1y.K 1y77.K 2b63.K 2b8k.K 2e2h.K 2e2i.K 2e2j.K 2ja5.K 2ja6.K 2ja7.K 2ja7.W 2ja8.K 2nvq.K 2nvs.K 2nvt.K 2nvx.K 2nvy.K 2nvz.K 2r7z.K 2r92.K 2r93.K 2vum.K 2yu9.K 3cqz.K 3fki.K 3gtg.K 3gtj.K 3gtk.K 3gtl.K 3gtm.K 3gto.K 3gtp.K 3gtq.K 3h3v.L 3hou.K 3hou.W 3hov.K 3how.K 3hox.K 3hoy.K 3hoz.K 3i4m.K 3i4n.K 3j0k.K 3j1n.K 3k1f.K 3k7a.K 3m3y.K 3m4o.K 3po2.K 3po3.K 3qt1.K 3rzd.K 3rzo.K 3s14.K 3s15.K 3s16.K 3s17.K 3s1m.K 3s1n.K 3s1q.K 3s1r.K 3s2d.K 3s2h.K 4a3b.K 4a3c.K 4a3d.K 4a3e.K 4a3f.K 4a3g.K 4a3i.K 4a3j.K 4a3k.K 4a3l.K 4a3m.K 4a93.K 4bbr.K 4bbs.K YOL005C YOL005C YOL005C YOL005c___KOG4392 YOL005C YOL005C YOL005C

Jump to [ Top of page · Domain architecture · Domain assignment details ]