SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL010W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL010W
Domain Number 1 Region: 13-234
Classification Level Classification E-value
Superfamily EPT/RTPC-like 2.22e-61
Family RNA 3'-terminal phosphate cyclase, RPTC 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOL010W   Protein: S000005370
Sequence length 367
Comment RCL1 SGDID:S000005370, Chr XV from 307939-309042, Verified ORF, "RNA terminal phosphate cyclase-like protein involved in rRNA processing at sites A0, A1, and A2; does not possess detectable RNA cyclase activity"
Sequence
MSSSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVT
NGSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKG
ITASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITM
HEIDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPG
WGITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVY
MVIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFT
NTSKKIA
Download sequence
Identical sequences A6ZNJ6 B3LJ46 C7GJW2 C8ZHV5 E7M057 E7QKJ3 H0GNA7 Q08096 W7P9I2 W7R718
YOL010W YOL010W YOL010W YOL010W YOL010W YOL010W NYSGXRC-P101 4932.YOL010W YOL010W SCRT_01393 YOL010W tr|A6ZNJ6|A6ZNJ6_YEAS7 YOL010W YOL010W YOL010W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]