SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL010W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL010W
Domain Number 1 Region: 13-234
Classification Level Classification E-value
Superfamily EPT/RTPC-like 2.22e-61
Family RNA 3'-terminal phosphate cyclase, RPTC 0.0029
Further Details:      
 

Protein sequence

External link(s) Locus: YOL010W   Protein: S000005370
Sequence length 367
Comment RCL1 SGDID:S000005370, Chr XV from 307939-309042, Verified ORF, "RNA terminal phosphate cyclase-like protein involved in rRNA processing at sites A0, A1, and A2; does not possess detectable RNA cyclase activity"
Sequence
MSSSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVT
NGSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKG
ITASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITM
HEIDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPG
WGITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVY
MVIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFT
NTSKKIA
Download sequence
Identical sequences A6ZNJ6 B3LJ46 C7GJW2 C8ZHV5 E7M057 E7QKJ3 H0GNA7 Q08096 W7P9I2 W7R718
YOL010W YOL010W YOL010W YOL010W YOL010W YOL010W NYSGXRC-P101 4932.YOL010W YOL010W SCRT_01393 YOL010W tr|A6ZNJ6|A6ZNJ6_YEAS7 YOL010W YOL010W YOL010W

Jump to [ Top of page · Domain architecture · Domain assignment details ]