SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL013C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL013C
Domain Number 1 Region: 334-406
Classification Level Classification E-value
Superfamily RING/U-box 3.73e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 37.02
transferase complex 1.423 24.01
ribonucleoprotein complex 1.414 21.1
integral component of plasma membrane 1.462 14.03
receptor complex 1.511 14.03
cytoplasmic ribonucleoprotein granule 1.98 11.96
microbody 1.95 11.88
condensed chromosome 2.187 10.58
sarcolemma 1.922 9.16
chromosomal part 1.477 7.89

Protein sequence

External link(s) Locus: YOL013C   Protein: S000005373
Sequence length 551
Comment HRD1 SGDID:S000005373, Chr XV from 303036-301381, reverse complement, Verified ORF, "Ubiquitin-protein ligase required for endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins; genetically linked to the unfolded protein response (UPR); regulated through association with Hrd3p; contains an H2 ring finger"
Sequence
MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST
LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV
FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDI
ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVE
SDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL
KDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSP
NQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSD
ITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPT
WYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKK
IVIPDKFIQHI
Download sequence
Identical sequences N1NWS6 Q08109
YOL013C YOL013C YOL013C YOL013C 4932.YOL013C YOL013C YOL013C 2403S

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]