SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL013C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL013C
Domain Number 1 Region: 334-406
Classification Level Classification E-value
Superfamily RING/U-box 3.73e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Protein sequence

External link(s) Locus: YOL013C   Protein: S000005373
Sequence length 551
Comment HRD1 SGDID:S000005373, Chr XV from 303036-301381, reverse complement, Verified ORF, "Ubiquitin-protein ligase required for endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins; genetically linked to the unfolded protein response (UPR); regulated through association with Hrd3p; contains an H2 ring finger"
Sequence
MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST
LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV
FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDI
ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVE
SDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL
KDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSP
NQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSD
ITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPT
WYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKK
IVIPDKFIQHI
Download sequence
Identical sequences Q08109
YOL013C 4932.YOL013C YOL013C YOL013C YOL013C 2403S YOL013C YOL013C

Jump to [ Top of page · Domain architecture · Domain assignment details ]