SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YOL013C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL013C
Domain Number 1 Region: 334-406
Classification Level Classification E-value
Superfamily RING/U-box 3.73e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 32.55
ribonucleoprotein complex 1.415 21.15
vacuolar part 1.621 16.14
integral to plasma membrane 1.469 14.05
receptor complex 1.51 14.05
microbody 1.955 11.91
chromatin 1.906 10.81
condensed chromosome 2.187 10.59
nucleoplasm part 1.419 9.18
nuclear body 1.911 9.18

Protein sequence

External link(s) Locus: YOL013C   Protein: S000005373
Sequence length 551
Comment HRD1 SGDID:S000005373, Chr XV from 303036-301381, reverse complement, Verified ORF, "Ubiquitin-protein ligase required for endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins; genetically linked to the unfolded protein response (UPR); regulated through association with Hrd3p; contains an H2 ring finger"
Sequence
MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST
LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV
FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDI
ESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVE
SDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL
KDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSP
NQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSD
ITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPT
WYTFPLHKTGDNSVGSSRSAYEFLITNSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKK
IVIPDKFIQHI
Download sequence
Identical sequences N1NWS6 Q08109
YOL013C 2403S YOL013C 4932.YOL013C YOL013C YOL013C YOL013C YOL013C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]