SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YOL021C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL021C
Domain Number 1 Region: 479-909
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-127
Family RNB domain-like 0.000000000000693
Further Details:      
 
Domain Number 2 Region: 253-398
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.45e-36
Family Cold shock DNA-binding domain-like 0.000000105
Further Details:      
 
Domain Number 3 Region: 389-494
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-24
Family Cold shock DNA-binding domain-like 0.00000527
Further Details:      
 
Domain Number 4 Region: 912-993
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.34e-19
Family Cold shock DNA-binding domain-like 0.00000866
Further Details:      
 
Domain Number 5 Region: 86-207
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000155
Family PIN domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
DNA-dependent DNA replication 1.996 68.7
DNA catabolic process 2.216 47.9
DNA duplex unwinding 1.979 46.97
double-strand break repair 1.887 44.68
tRNA aminoacylation 2.002 39.07
translation 1.521 35.23
telomere organization 2.104 26.38
RNA processing 1.458 21.38
mRNA metabolic process 1.627 21.38
RNA 3'-end processing 2.027 21.38
Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 55.13
replication fork 2.198 34.31
nucleoplasm part 1.418 33.7
nuclear chromosome 1.72 24.48
chromosomal part 1.477 22.68
ribonucleoprotein complex 1.418 20.29
ribosomal subunit 2.011 19.49
DNA-directed RNA polymerase complex 2.005 12.25
ribonucleoprotein granule 1.999 10.35
mitochondrial inner membrane 1.752 9.99

Protein sequence

External link(s) Locus: YOL021C   Protein: S000005381
Sequence length 1001
Comment DIS3 SGDID:S000005381, Chr XV from 285427-282422, reverse complement, Verified ORF, "Catalytic component of the exosome, involved in RNA processing and degradation; binds Gsp1p/Ran and enhances the GEF activity of Srm1p; implicated in mitotic control; homologous to the E. coli RNase R of the RNase II family"
Sequence
MSVPAIAPRRKRLADGLSVTQKVFVRSRNGGATKIVREHYLRSDIPCLSRSCTKCPQIVV
PDAQNELPKFILSDSPLELSAPIGKHYVVLDTNVVLQAIDLLENPNCFFDVIVPQIVLDE
VRNKSYPVYTRLRTLCRDSDDHKRFIVFHNEFSEHTFVERLPNETINDRNDRAIRKTCQW
YSEHLKPYDINVVLVTNDRLNREAATKEVESNIITKSLVQYIELLPNADDIRDSIPQMDS
FDKDLERDTFSDFTFPEYYSTARVMGGLKNGVLYQGNIQISEYNFLEGSVSLPRFSKPVL
IVGQKNLNRAFNGDQVIVELLPQSEWKAPSSIVLDSEHFDVNDNPDIEAGDDDDNNESSS
NTTVISDKQRRLLAKDAMIAQRSKKIQPTAKVVYIQRRSWRQYVGQLAPSSVDPQSSSTQ
NVFVILMDKCLPKVRIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAE
TEALLLEHDVEYRPFSKKVLECLPAEGHDWKAPTKLDDPEAVSKDPLLTKRKDLRDKLIC
SIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAARGTSVYLVDKR
IDMLPMLLGTDLCSLKPYVDRFAFSVIWELDDSANIVNVNFMKSVIRSREAFSYEQAQLR
IDDKTQNDELTMGMRALLKLSVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKL
LATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISL
ESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYT
HFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIE
YYVGQVMRNNESTETGYVIKVFNNGIVVLVPKFGVEGLIRLDNLTEDPNSAAFDEVEYKL
TFVPTNSDKPRDVYVFDKVEVQVRSVMDPITSKRKAELLLK
Download sequence
Identical sequences C7GVF0 Q08162
NYSGXRC-6391a YR71 YOL021C 4932.YOL021C YOL021C YOL021C YOL021C YOL021C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]