SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL021C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL021C
Domain Number 1 Region: 479-909
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-127
Family RNB domain-like 6.93e-13
Further Details:      
 
Domain Number 2 Region: 253-398
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.45e-36
Family Cold shock DNA-binding domain-like 1.05e-07
Further Details:      
 
Domain Number 3 Region: 389-494
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-24
Family Cold shock DNA-binding domain-like 5.27e-06
Further Details:      
 
Domain Number 4 Region: 912-993
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.34e-19
Family Cold shock DNA-binding domain-like 8.66e-06
Further Details:      
 
Domain Number 5 Region: 86-207
Classification Level Classification E-value
Superfamily PIN domain-like 1.55e-09
Family PIN domain 0.036
Further Details:      
 

Protein sequence

External link(s) Locus: YOL021C   Protein: S000005381
Sequence length 1001
Comment DIS3 SGDID:S000005381, Chr XV from 285427-282422, reverse complement, Verified ORF, "Catalytic component of the exosome, involved in RNA processing and degradation; binds Gsp1p/Ran and enhances the GEF activity of Srm1p; implicated in mitotic control; homologous to the E. coli RNase R of the RNase II family"
Sequence
MSVPAIAPRRKRLADGLSVTQKVFVRSRNGGATKIVREHYLRSDIPCLSRSCTKCPQIVV
PDAQNELPKFILSDSPLELSAPIGKHYVVLDTNVVLQAIDLLENPNCFFDVIVPQIVLDE
VRNKSYPVYTRLRTLCRDSDDHKRFIVFHNEFSEHTFVERLPNETINDRNDRAIRKTCQW
YSEHLKPYDINVVLVTNDRLNREAATKEVESNIITKSLVQYIELLPNADDIRDSIPQMDS
FDKDLERDTFSDFTFPEYYSTARVMGGLKNGVLYQGNIQISEYNFLEGSVSLPRFSKPVL
IVGQKNLNRAFNGDQVIVELLPQSEWKAPSSIVLDSEHFDVNDNPDIEAGDDDDNNESSS
NTTVISDKQRRLLAKDAMIAQRSKKIQPTAKVVYIQRRSWRQYVGQLAPSSVDPQSSSTQ
NVFVILMDKCLPKVRIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAE
TEALLLEHDVEYRPFSKKVLECLPAEGHDWKAPTKLDDPEAVSKDPLLTKRKDLRDKLIC
SIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAARGTSVYLVDKR
IDMLPMLLGTDLCSLKPYVDRFAFSVIWELDDSANIVNVNFMKSVIRSREAFSYEQAQLR
IDDKTQNDELTMGMRALLKLSVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKL
LATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISL
ESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYT
HFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIE
YYVGQVMRNNESTETGYVIKVFNNGIVVLVPKFGVEGLIRLDNLTEDPNSAAFDEVEYKL
TFVPTNSDKPRDVYVFDKVEVQVRSVMDPITSKRKAELLLK
Download sequence
Identical sequences C7GVF0 Q08162
YOL021C 4932.YOL021C YOL021C YOL021C YOL021C NYSGXRC-6391a YR71 YOL021C

Jump to [ Top of page · Domain architecture · Domain assignment details ]