SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL030W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL030W
Domain Number 1 Region: 50-308
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.81e-56
Family beta-glycanases 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external encapsulating structure 1.632 21.56
endoplasmic reticulum part 1.429 19.07
microvillus 1.896 10.4
external side of plasma membrane 1.922 7.48
extracellular space 1.523 5.72
cell-cell junction 1.375 5.52
symplast 2.045 4.79
brush border 1.48 4.6
lytic vacuole 1.57 4.48
vacuolar part 1.621 4.41

Protein sequence

External link(s) Locus: YOL030W   Protein: S000005390
Sequence length 484
Comment GAS5 SGDID:S000005390, Chr XV from 268188-269642, Verified ORF, "1,3-beta-glucanosyltransferase, has similarity to Gas1p; localizes to the cell wall"
Sequence
MLLRSLTSAFVLSAGLAQAASSSNSSTPSIEIKGNAFFNSESGERFYIRGVDYQPGGSSN
LTDPLADASVCDRDVPVLKDLGINTVRVYTVDNSQDHSHCMKLLQENGIYLILDVNTPTS
AISRYDPACSYNADYLQNVFATIDTFADYDNVLGFFAGNEVINSVNTTNTATYVKAVVRD
MKKYIKARKYRQIPVGYSAADIVANRQLAAEYFNCGDEADARIDMFGVNDYSWCGESSFV
VSGYSTKMKLYQDYSVPVFLSEFGCNQVKSSRPFTEIEAIYSTQMSSVFSGGLVYEYSNE
TNNYGLVQIDGDKVTKLTDFENLKNEYSKVSNPEGNGGYSTSNNYSTCPDYEKGVWEANN
TLPAMPSAASAYFTSGAGSPMGTGIATQQSCDAKDDDDEEDDDTSSSSSSSSSSSSSASS
SSESSSSTSKASSSSPSASETSLLKSAASATSSSQSSSKSKGAAGIIEIPLIFRALAELY
NLVL
Download sequence
Identical sequences A6ZNH7 Q08193 W7PKS6
YOL030W 4932.YOL030W YOL030W YOL030W YOL030W tr|A6ZNH7|A6ZNH7_YEAS7 YOL030W YOL030W YOL030W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]