SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL030W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL030W
Domain Number 1 Region: 50-308
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.81e-56
Family beta-glycanases 0.033
Further Details:      
 

Protein sequence

External link(s) Locus: YOL030W   Protein: S000005390
Sequence length 484
Comment GAS5 SGDID:S000005390, Chr XV from 268188-269642, Verified ORF, "1,3-beta-glucanosyltransferase, has similarity to Gas1p; localizes to the cell wall"
Sequence
MLLRSLTSAFVLSAGLAQAASSSNSSTPSIEIKGNAFFNSESGERFYIRGVDYQPGGSSN
LTDPLADASVCDRDVPVLKDLGINTVRVYTVDNSQDHSHCMKLLQENGIYLILDVNTPTS
AISRYDPACSYNADYLQNVFATIDTFADYDNVLGFFAGNEVINSVNTTNTATYVKAVVRD
MKKYIKARKYRQIPVGYSAADIVANRQLAAEYFNCGDEADARIDMFGVNDYSWCGESSFV
VSGYSTKMKLYQDYSVPVFLSEFGCNQVKSSRPFTEIEAIYSTQMSSVFSGGLVYEYSNE
TNNYGLVQIDGDKVTKLTDFENLKNEYSKVSNPEGNGGYSTSNNYSTCPDYEKGVWEANN
TLPAMPSAASAYFTSGAGSPMGTGIATQQSCDAKDDDDEEDDDTSSSSSSSSSSSSSASS
SSESSSSTSKASSSSPSASETSLLKSAASATSSSQSSSKSKGAAGIIEIPLIFRALAELY
NLVL
Download sequence
Identical sequences A6ZNH7 Q08193 W7PKS6
YOL030W 4932.YOL030W YOL030W YOL030W YOL030W tr|A6ZNH7|A6ZNH7_YEAS7 YOL030W YOL030W YOL030W

Jump to [ Top of page · Domain architecture · Domain assignment details ]