SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YOL038W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL038W
Domain Number 1 Region: 3-242
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.16e-74
Family Proteasome subunits 0.000000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
side of membrane 1.701 22.27
external side of plasma membrane 1.827 22.27
cytosol 1.301 13.15
ribonucleoprotein complex 1.414 8.37
cytoplasmic ribonucleoprotein granule 1.98 8.37
extracellular organelle 1.606 4.81

Protein sequence

External link(s) Locus: YOL038W   Protein: S000005398
Sequence length 254
Comment PRE6 SGDID:S000005398, Chr XV from 255336-256100, Verified ORF, "Alpha 4 subunit of the 20S proteasome; may replace alpha 3 subunit (Pre9p) under stress conditions to create a more active proteasomal isoform; GFP-fusion protein relocates from cytosol to the mitochondrial surface upon oxidative stress"
Sequence
MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRIT
PSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRY
TQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYD
RKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEK
QEQQEQDKKKKSNH
Download sequence
Identical sequences A6ZNH1 B3LJ21 B5VRL3 C7GK06 C8ZHS7 E7KHQ1 E7KU35 E7M035 E7Q939 G2WMJ5 H0GN83 N1NWR3 P40303 W7QUT4
4932.YOL038W YOL038W YOL038W YOL038W YOL038W YOL038w___KOG0183 YOL038W YOL038W YOL038W tr|A6ZNH1|A6ZNH1_YEAS7 2zcyC YOL038W YOL038W YOL038W YOL038W YOL038W YOL038W YOL038W YOL038W YOL038W YOL038W YOL038W YOL038W YOL038W 1fnt.D 1fnt.R 1z7q.D 1z7q.R 2zcy.C 2zcy.Q 3bdm.C 3bdm.Q 3nzj.C 3nzj.Q 3nzw.C 3nzw.Q 3nzx.C 3nzx.Q 3un4.C 3un4.Q 3un8.C 3un8.Q 4b4t.D 4bgr.D 4c0v.D 4cr2.D 4cr3.D 4cr4.D 4g4s.D 4inr.C 4inr.Q 4int.C 4int.Q 4inu.C 4inu.Q 4j70.C 4j70.Q 4jsq.C 4jsq.Q 4jsu.C 4jsu.Q 4jt0.C 4jt0.Q 4ltc.C 4ltc.Q 4nnn.C 4nnn.Q 4nnw.C 4nnw.Q 4no1.C 4no1.Q 4no6.C 4no6.Q 4no8.C 4no8.Q 4no9.C 4no9.Q 4q1s.C 4q1s.Q 4qby.C 4qby.Q 4qlq.C 4qlq.Q 4qls.C 4qls.Q 4qlt.C 4qlt.Q 4qlu.C 4qlu.Q 4qlv.C 4qlv.Q 4r02.C 4r02.Q YOL038W SCRT_01365 YOL038W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]